BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 023930
         (275 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|A5EXM6|MUTL_DICNV DNA mismatch repair protein MutL OS=Dichelobacter nodosus (strain
           VCS1703A) GN=mutL PE=3 SV=1
          Length = 590

 Score = 31.6 bits (70), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 22/45 (48%), Gaps = 1/45 (2%)

Query: 10  AATTPSSSSQPKMPPQTQPNGTHHHQRRPHP-PPPPPLQPQSQYH 53
           A  TP SS+ PK+P  T      HH+  PH    PP LQ    Y+
Sbjct: 331 AQLTPLSSASPKLPESTTATAQPHHKMIPHTFARPPRLQETKAYY 375


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.319    0.132    0.393 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 100,263,482
Number of Sequences: 539616
Number of extensions: 4140424
Number of successful extensions: 45825
Number of sequences better than 100.0: 50
Number of HSP's better than 100.0 without gapping: 254
Number of HSP's successfully gapped in prelim test: 403
Number of HSP's that attempted gapping in prelim test: 38151
Number of HSP's gapped (non-prelim): 5621
length of query: 275
length of database: 191,569,459
effective HSP length: 116
effective length of query: 159
effective length of database: 128,974,003
effective search space: 20506866477
effective search space used: 20506866477
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 60 (27.7 bits)