BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023944
(275 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PZ9|A Chain A, Native Structure Of Endo-1,4-Beta-D-Mannanase From
Thermotoga Petrophila Rku-1
pdb|3PZG|A Chain A, I222 Crystal Form Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1
pdb|3PZI|A Chain A, Structure Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1 In Complex With Beta-D-Glucose
pdb|3PZM|A Chain A, Structure Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1 With Three Glycerol Molecules
pdb|3PZN|A Chain A, Structure Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1 With Citrate And Glycerol
pdb|3PZO|A Chain A, Structure Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1 In Complex With Three Maltose Molecules
pdb|3PZQ|A Chain A, Structure Of The Hyperthermostable
Endo-1,4-Beta-D-Mannanase From Thermotoga Petrophila
Rku-1 With Maltose And Glycerol
Length = 383
Score = 29.3 bits (64), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 11/33 (33%), Positives = 19/33 (57%)
Query: 34 DPGPKTRELTGFIDDKMFSVDRDRYFRPQPTMF 66
D G K + GF+D + + D++ Y P+P +F
Sbjct: 54 DMGIKVLRIWGFLDGESYCRDKNTYMHPEPGVF 86
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.133 0.400
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,271,554
Number of Sequences: 62578
Number of extensions: 261111
Number of successful extensions: 507
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 506
Number of HSP's gapped (non-prelim): 1
length of query: 275
length of database: 14,973,337
effective HSP length: 97
effective length of query: 178
effective length of database: 8,903,271
effective search space: 1584782238
effective search space used: 1584782238
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)