BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 023988
(274 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3PBP|A Chain A, Structure Of The Yeast Heterotrimeric Nup82-Nup159-Nup116
Nucleoporin Complex
pdb|3PBP|D Chain D, Structure Of The Yeast Heterotrimeric Nup82-Nup159-Nup116
Nucleoporin Complex
pdb|3PBP|G Chain G, Structure Of The Yeast Heterotrimeric Nup82-Nup159-Nup116
Nucleoporin Complex
pdb|3PBP|J Chain J, Structure Of The Yeast Heterotrimeric Nup82-Nup159-Nup116
Nucleoporin Complex
Length = 452
Score = 30.8 bits (68), Expect = 0.88, Method: Compositional matrix adjust.
Identities = 17/57 (29%), Positives = 30/57 (52%)
Query: 215 AQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNPALT 271
A +S++ ++ L + + E+ E AT+ R P++AY+ SN+ L N LT
Sbjct: 390 ASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALXSNKTLT 446
>pdb|3TKN|A Chain A, Structure Of The Nup82-Nup159-Nup98 Heterotrimer
pdb|3TKN|D Chain D, Structure Of The Nup82-Nup159-Nup98 Heterotrimer
pdb|3TKN|G Chain G, Structure Of The Nup82-Nup159-Nup98 Heterotrimer
Length = 452
Score = 30.8 bits (68), Expect = 0.95, Method: Compositional matrix adjust.
Identities = 17/57 (29%), Positives = 30/57 (52%)
Query: 215 AQLISEATSKFGLGLIELRRIEASREIAATLARSPHVAYLPGGKNSNMLLALNPALT 271
A +S++ ++ L + + E+ E AT+ R P++AY+ SN+ L N LT
Sbjct: 390 ASTLSKSINESDLNPLAGLKFESKLEDIATIERIPNLAYINWNDQSNLALMSNKTLT 446
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.382
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,526,226
Number of Sequences: 62578
Number of extensions: 232287
Number of successful extensions: 491
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 489
Number of HSP's gapped (non-prelim): 4
length of query: 274
length of database: 14,973,337
effective HSP length: 97
effective length of query: 177
effective length of database: 8,903,271
effective search space: 1575878967
effective search space used: 1575878967
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 51 (24.3 bits)