Query         023996
Match_columns 274
No_of_seqs    162 out of 958
Neff          6.2 
Searched_HMMs 46136
Date          Fri Mar 29 08:10:24 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/023996.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/023996hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 3.7E-44   8E-49  294.4   6.2  129    4-136     1-129 (129)
  2 PHA00692 hypothetical protein   40.8      11 0.00024   27.2   0.4    9    3-11     36-44  (74)
  3 smart00265 BH4 BH4 Bcl-2 homol  27.7      53  0.0012   19.9   1.8   19   13-31      4-22  (27)
  4 PF07960 CBP4:  CBP4;  InterPro  20.8      51  0.0011   27.4   1.1   12   10-21     29-40  (128)
  5 PF02180 BH4:  Bcl-2 homology r  17.5 1.2E+02  0.0027   18.4   2.0   17   14-30      5-21  (27)
  6 PF13822 ACC_epsilon:  Acyl-CoA  15.7      77  0.0017   22.7   0.9    9   11-19     10-18  (62)
  7 cd00490 Met_repressor_MetJ Met  15.2 1.7E+02  0.0037   22.8   2.8   38   11-53     50-87  (103)
  8 PLN02417 dihydrodipicolinate s  14.7   1E+02  0.0023   28.2   1.8   18    4-22    103-120 (280)
  9 smart00707 RPEL Repeat in Dros  14.3 1.2E+02  0.0025   18.3   1.3   13    7-19      6-18  (26)
 10 KOG1334 WD40 repeat protein [G  14.2 3.7E+02   0.008   27.4   5.5   89   15-112   303-425 (559)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=3.7e-44  Score=294.38  Aligned_cols=129  Identities=47%  Similarity=0.976  Sum_probs=96.2

Q ss_pred             CCCCceEcCChHHHHHHHHHHHhcCCCCCCCCceeeccCCCCCCCCCccccccccCCCCceEEEeccCcccccCCCCCcc
Q 023996            4 LPPGYRFFPTEEELVSFYLINKLEGKRQELHRVIPVIRLYEIEPWHLPKLCGEKCQGDTEQWFFFTPRQEREERGGRPSR   83 (274)
Q Consensus         4 LPpGfRF~PTDeELV~~YL~~Ki~g~~~~~~~~I~~~Dvy~~~PwdLp~~~~~~~~g~~~~wyFFt~r~~k~~~G~R~~R   83 (274)
                      |||||||+|||+|||.+||++|+.|.+++...+|+++|||++|||+|+...    .+.+++||||+++++++.+|.|++|
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~----~~~~~~~yFF~~~~~~~~~~~r~~R   76 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKF----KGGDEEWYFFSPRKKKYPNGGRPNR   76 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHS----SS-SSEEEEEEE----------S-E
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhc----cCCCceEEEEEecccccCCcccccc
Confidence            899999999999999999999999999877789999999999999999521    1244479999999999999999999


Q ss_pred             ccccceEEecCCCeeeecCCCcEEEEEEEEEEecCcCCCCCccCcEEEEEEeC
Q 023996           84 TTASGYWKATGSPSYVYSSDNRVIGVKKTMVFYKGKAPTGRKTKWKMHEYRAI  136 (274)
Q Consensus        84 ~t~~G~Wk~~G~~k~V~~~~g~viG~Kktl~Fy~g~~~~g~kT~W~M~EY~l~  136 (274)
                      ++++|+||++|+.+.|.+.++.+||+|++|+||.++.+++.+|+|+||||+|.
T Consensus        77 ~~~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   77 VTGGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EETTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             cccceEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            99999999999999999977999999999999998888899999999999983


No 2  
>PHA00692 hypothetical protein
Probab=40.81  E-value=11  Score=27.16  Aligned_cols=9  Identities=67%  Similarity=1.368  Sum_probs=7.4

Q ss_pred             CCCCCceEc
Q 023996            3 ELPPGYRFF   11 (274)
Q Consensus         3 ~LPpGfRF~   11 (274)
                      +.||||||-
T Consensus        36 eyppgfrfg   44 (74)
T PHA00692         36 EYPPGFRFG   44 (74)
T ss_pred             ecCCCcccc
Confidence            579999995


No 3  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=27.72  E-value=53  Score=19.94  Aligned_cols=19  Identities=32%  Similarity=0.333  Sum_probs=15.1

Q ss_pred             ChHHHHHHHHHHHhcCCCC
Q 023996           13 TEEELVSFYLINKLEGKRQ   31 (274)
Q Consensus        13 TDeELV~~YL~~Ki~g~~~   31 (274)
                      +-.|||.+|+.-||.-+-.
T Consensus         4 ~nRelV~~yv~yKLsQrgy   22 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGY   22 (27)
T ss_pred             chHHHHHHHHHHHHhhcCC
Confidence            4579999999999975443


No 4  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=20.83  E-value=51  Score=27.36  Aligned_cols=12  Identities=58%  Similarity=0.703  Sum_probs=9.8

Q ss_pred             EcCChHHHHHHH
Q 023996           10 FFPTEEELVSFY   21 (274)
Q Consensus        10 F~PTDeELV~~Y   21 (274)
                      =.||||||+..|
T Consensus        29 ~tPTeEeL~~r~   40 (128)
T PF07960_consen   29 TTPTEEELFKRY   40 (128)
T ss_pred             cCCCHHHHHHhc
Confidence            369999999764


No 5  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=17.45  E-value=1.2e+02  Score=18.38  Aligned_cols=17  Identities=35%  Similarity=0.462  Sum_probs=13.7

Q ss_pred             hHHHHHHHHHHHhcCCC
Q 023996           14 EEELVSFYLINKLEGKR   30 (274)
Q Consensus        14 DeELV~~YL~~Ki~g~~   30 (274)
                      -.|||.+|+.-||.-+-
T Consensus         5 nR~lV~~yi~yKLsQrg   21 (27)
T PF02180_consen    5 NRELVEDYISYKLSQRG   21 (27)
T ss_dssp             HHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHhhhcC
Confidence            47999999999996543


No 6  
>PF13822 ACC_epsilon:  Acyl-CoA carboxylase epsilon subunit
Probab=15.72  E-value=77  Score=22.67  Aligned_cols=9  Identities=56%  Similarity=0.818  Sum_probs=7.6

Q ss_pred             cCChHHHHH
Q 023996           11 FPTEEELVS   19 (274)
Q Consensus        11 ~PTDeELV~   19 (274)
                      +||||||-.
T Consensus        10 nPt~eElAA   18 (62)
T PF13822_consen   10 NPTDEELAA   18 (62)
T ss_pred             CCCHHHHHH
Confidence            799999864


No 7  
>cd00490 Met_repressor_MetJ Met Repressor, MetJ.  MetJ is a bacterial regulatory protein that uses S-adenosylmethionine (SAM) as a corepressor to regulate the production of Methionine.  MetJ binds arrays of two to five adjacent copies of an eight base-pair 'metbox' sequence.  MetJ forms sufficiently strong interactions with the sugar-phosphate backbone to accomodate sequence variation in natural operators. However, it is very sensitive to particular base changes in the operator. MetJ exists as a homodimer.
Probab=15.24  E-value=1.7e+02  Score=22.83  Aligned_cols=38  Identities=16%  Similarity=0.168  Sum_probs=31.1

Q ss_pred             cCChHHHHHHHHHHHhcCCCCCCCCceeeccCCCCCCCCCccc
Q 023996           11 FPTEEELVSFYLINKLEGKRQELHRVIPVIRLYEIEPWHLPKL   53 (274)
Q Consensus        11 ~PTDeELV~~YL~~Ki~g~~~~~~~~I~~~Dvy~~~PwdLp~~   53 (274)
                      |-|..||++.-...-..|+|++.     +.|+-...|..+|..
T Consensus        50 HATNSELLCEAFLHAfTGQPLP~-----D~Dl~K~~~d~iP~~   87 (103)
T cd00490          50 HATNSELLCEAFLHAFTGQPLPD-----DADLRKERSDEIPEA   87 (103)
T ss_pred             hcccHHHHHHHHHHHhcCCCCCC-----hhhhhhcCcccccHH
Confidence            56888999988888889999854     578888889999874


No 8  
>PLN02417 dihydrodipicolinate synthase
Probab=14.69  E-value=1e+02  Score=28.21  Aligned_cols=18  Identities=22%  Similarity=0.418  Sum_probs=14.4

Q ss_pred             CCCCceEcCChHHHHHHHH
Q 023996            4 LPPGYRFFPTEEELVSFYL   22 (274)
Q Consensus         4 LPpGfRF~PTDeELV~~YL   22 (274)
                      +|| |.|.||++||+.||-
T Consensus       103 ~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        103 INP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             cCC-ccCCCCHHHHHHHHH
Confidence            455 568999999999874


No 9  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=14.29  E-value=1.2e+02  Score=18.28  Aligned_cols=13  Identities=38%  Similarity=0.332  Sum_probs=11.0

Q ss_pred             CceEcCChHHHHH
Q 023996            7 GYRFFPTEEELVS   19 (274)
Q Consensus         7 GfRF~PTDeELV~   19 (274)
                      ...++||-+|||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            4568999999997


No 10 
>KOG1334 consensus WD40 repeat protein [General function prediction only]
Probab=14.17  E-value=3.7e+02  Score=27.41  Aligned_cols=89  Identities=22%  Similarity=0.375  Sum_probs=45.0

Q ss_pred             HHHHHHHHHHHhcCCCC--CCCCceeecc-----------CCCCCCCCCccccccccCCCCceEEEeccCccccc-----
Q 023996           15 EELVSFYLINKLEGKRQ--ELHRVIPVIR-----------LYEIEPWHLPKLCGEKCQGDTEQWFFFTPRQEREE-----   76 (274)
Q Consensus        15 eELV~~YL~~Ki~g~~~--~~~~~I~~~D-----------vy~~~PwdLp~~~~~~~~g~~~~wyFFt~r~~k~~-----   76 (274)
                      .|.+..|=.+++.....  .+..+.+..+           +|.+++-+|-..      ..++..|||.+ ..+..     
T Consensus       303 dqf~RvYD~R~~~~e~~n~~~~~f~p~hl~~d~~v~ITgl~Ysh~~sElLaS------YnDe~IYLF~~-~~~~G~~p~~  375 (559)
T KOG1334|consen  303 DQFARVYDQRRIDKEENNGVLDKFCPHHLVEDDPVNITGLVYSHDGSELLAS------YNDEDIYLFNK-SMGDGSEPDP  375 (559)
T ss_pred             hhhhhhhcccchhhccccchhhhcCCccccccCcccceeEEecCCccceeee------ecccceEEecc-ccccCCCCCC
Confidence            35566677777776533  2233333333           455555555431      23445799944 32222     


Q ss_pred             ------------CCCCCcccccc-ceEEecCCCeeeecC-C-CcE-EEEEEE
Q 023996           77 ------------RGGRPSRTTAS-GYWKATGSPSYVYSS-D-NRV-IGVKKT  112 (274)
Q Consensus        77 ------------~G~R~~R~t~~-G~Wk~~G~~k~V~~~-~-g~v-iG~Kkt  112 (274)
                                  +|.|-+||+++ -+|-+..  ..|+++ | |.| |..|++
T Consensus       376 ~s~~~~~~k~vYKGHrN~~TVKgVNFfGPrs--EyVvSGSDCGhIFiW~K~t  425 (559)
T KOG1334|consen  376 SSPREQYVKRVYKGHRNSRTVKGVNFFGPRS--EYVVSGSDCGHIFIWDKKT  425 (559)
T ss_pred             CcchhhccchhhcccccccccceeeeccCcc--ceEEecCccceEEEEecch
Confidence                        35566677653 4564332  234443 3 554 566554


Done!