BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024019
         (274 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring
           Finger) Domain Of Ring Finger Protein 126
          Length = 78

 Score = 27.7 bits (60), Expect = 7.8,   Method: Composition-based stats.
 Identities = 11/30 (36%), Positives = 19/30 (63%), Gaps = 1/30 (3%)

Query: 234 ECPICLEEFHVGNEVK-ISFLSIFYSSCSV 262
           ECP+C E++ +G  V+ +    +F+ SC V
Sbjct: 17  ECPVCKEDYALGESVRQLPCNHLFHDSCIV 46


>pdb|1RJ1|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco
 pdb|1RJ4|A Chain A, Structure Of A Cell Wall Invertase Inhibitor From Tobacco
           In Complex With Cd2+
 pdb|1RJ4|B Chain B, Structure Of A Cell Wall Invertase Inhibitor From Tobacco
           In Complex With Cd2+
 pdb|1RJ4|C Chain C, Structure Of A Cell Wall Invertase Inhibitor From Tobacco
           In Complex With Cd2+
 pdb|1RJ4|D Chain D, Structure Of A Cell Wall Invertase Inhibitor From Tobacco
           In Complex With Cd2+
          Length = 151

 Score = 27.7 bits (60), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 203 LYLTAAQREAVEALIQELPKFR---LKAVPTDCSECPICLEEFHVGNEVKISFLSI 255
           + LTA+  EA+EAL +  PKF    +     D  EC    EE+  G++   S L+I
Sbjct: 83  VILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQEC----EEYFKGSKSPFSALNI 134


>pdb|2CJ4|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco At Ph 4.6
 pdb|2CJ4|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco At Ph 4.6
 pdb|2CJ5|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco (Ph 5.0)
 pdb|2CJ6|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco (Ph 7.5)
 pdb|2CJ7|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco (ph 9.0)
 pdb|2CJ8|A Chain A, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco (Ph 9.5)
 pdb|2CJ8|B Chain B, Crystal Structure Of A Cell Wall Invertase Inhibitor From
           Tobacco (Ph 9.5)
          Length = 150

 Score = 27.3 bits (59), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 203 LYLTAAQREAVEALIQELPKFR---LKAVPTDCSECPICLEEFHVGNEVKISFLSI 255
           + LTA+  EA+EAL +  PKF    +     D  EC    EE+  G++   S L+I
Sbjct: 82  VILTASLPEAIEALTKGDPKFAEDGMVGSSGDAQEC----EEYFKGSKSPFSALNI 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.329    0.142    0.488 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,081,497
Number of Sequences: 62578
Number of extensions: 305326
Number of successful extensions: 666
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 665
Number of HSP's gapped (non-prelim): 7
length of query: 274
length of database: 14,973,337
effective HSP length: 97
effective length of query: 177
effective length of database: 8,903,271
effective search space: 1575878967
effective search space used: 1575878967
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)