Citrus Sinensis ID: 024022


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270----
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIHYETTGPEIWNDSGGKVDAFIAGIGTGGTVTGAGRFLKEKNPNIKVYGIEPSESAVLNGGQPGKHLIQGIGAGVIPPVLDVAMLDEVITVSSEEAIETSKLLALKEGLLQRQLLYE
cccccccccHHHHHHcccccEEccccccccccEEEEEEcccccccccHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHccccEEEEccccccHHHHHHHHHHccEEEEcccccccHHHHHHHHHHHHHcccCECcccccccccHHHHHHcHHHHHHHcccccccEEEEccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccccccccccccccccccEEEEcccHHHHHHHHHHHHHHcccHHHHHcc
****CEI*KDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIHYETTGPEIWNDSGGKVDAFIAGIGTGGTVTGAGRFLKEKNPNIKVYGIEPSESAVLNGGQPGKHLIQGIGAGVIPPVLDVAMLDEVITVSSEEAIETSKLLALKEGLLQRQLLY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDKCEIKKDVTELIGHTPMVYLNNVVDGCVARIAAKLEMMQPCSSVKDRIAYSMIKDAEDKGLITPGKTVLIELTSGNTGIGLAFIAASRGYKLIIIMPSTYSIERRIILRALGAEVYLADPAVGFEGFVKKGEEILNRTPNGYILGQFENPANPEIHYETTGPEIWNDSGGKVDAFIAGIGTGGTVTGAGRFLKEKNPNIKVYGIEPSESAVLNGGQPGKHLIQGIGAGVIPPVLDVAMLDEVITVSSEEAIETSKLLALKEGLLQRQLLYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
O-acetylserine sulfhydrylase Catalyzes the conversion of O-acetylserine (OAS) to cysteine through the elimination of acetate and addition of hydrogen sulfide.probableP0A535
O-acetylserine sulfhydrylase Catalyzes the conversion of O-acetylserine (OAS) to cysteine through the elimination of acetate and addition of hydrogen sulfide.probableP0A534
Cysteine synthase Catalyzes the conversion of O-acetylserine to cysteine. Also acts as a sensor of cysteine availability in the signal transduction pathway modulating CymR activity. When cysteine is present, the pool of O-acetylserine (OAS) is low, which leads to the formation of a CymR-CysK complex and transcriptional repression of the CymR regulon occurs. In the absence of cysteine, the OAS pool is high and the CymR-CysK complex is mostly dissociated, leading to a faster dissociation of CymR from its DNA targets and the lifting of CymR-dependent repression.probableP37887

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.47Cysteine synthase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AEC, chain A
Confidence level:very confident
Coverage over the Query: 4-272
View the alignment between query and template
View the model in PyMOL