Citrus Sinensis ID: 024026

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MGTGFLGETDSMQSLQTLMQGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKKLELFSYENNPYARIVREALCELELPYILQNVGDGSSRTKLLVDITGSKEVPYLIDPNTSTQIGDYKKILSYLFQSYSASPSPV
ccccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccCEEEEEcccccHHHHHHHHHHccccEEEECcccccccHHHHHHHHccccCEEEEECccccEEEcccHHHHHHHHHHccccccccccccccHHHccccccEEccccccccccccccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccccHHHHHHHcccccccEEEcccccCECccHHHHHHHHHHHcccccccc
******GETDSMQSLQTLMQGGDPSRERNDTLEVATSSLSTLARLPW**********************LQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKKLELFSYENNPYARIVREALCELELPYILQNVGDGSSRTKLLVDITGSKEVPYLIDPNTSTQIGDYKKILSYLFQSYS******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGTGFLGETDSMQSLQTLMQGGDPSRERNDTLEVATSSLSTLARLPWGSRSLSEGSDTQEISNSDSPTRLQLFEFEACPFCRRVREAITELDLSVEVFPCPKGSIRHREMVRRLGGKEQFPFLIDPNTGVSMYESGDIVNYLFQQYGKGRSPSTGLLESTLITGWMPTIFRAGRGMTLWEKARPDPPSKKLELFSYENNPYARIVREALCELELPYILQNVGDGSSRTKLLVDITGSKEVPYLIDPNTSTQIGDYKKILSYLFQSYSASPSPV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IR4, chain A
Confidence level:very confident
Coverage over the Query: 71-168
View the alignment between query and template
View the model in PyMOL
Template: 3IR4, chain A
Confidence level:very confident
Coverage over the Query: 192-269
View the alignment between query and template
View the model in PyMOL
Template: 3IBH, chain A
Confidence level:confident
Coverage over the Query: 70-219
View the alignment between query and template
View the model in PyMOL