Citrus Sinensis ID: 024054

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MRLVQRLPLMANSLATTGLSKTSWQSRPLLSFLRTQTLLNSLSLYPKINYLLLCSCSQSQTSPDFSNLILEQSSKRGPLEPGLYLVATPIGNLEDITLRALRVLKSANVILSEDTRHSGKLLQYYNIKTPLLSYHKFNESQREQTVLNRLKQGEIVALISDAGTPGISDPGTELAKLCVDEKIPVVPIPGASAFVAALSASGLATDEFTFVGFLPKHARSRTERLMLSANEVKTQIFYVPPHKLLQFLEETSLLFGYSRYIRYLKILFLFCQL
ccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccHHHHHHHcccccccccHHHHHHHHcccccccccccEEEEcccccccccccHHHHHHHHHHcEEcccccHHHHHHHHHccccccccHHHHHHHHcHHHHHHHHHHccccEEEEccccccccccccHHHHHHHHHccccEECcccccHHHHHHHHcccccccEEEECccccccHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHcccccEEEEEcccccccc
*******PLMANSLATTGLSKTSWQSRPLLSFLRTQTLLNSLSLYPKINYLLLCSCS**********************EPGLYLVATPIGNLEDITLRALRVLKSANVILSEDTRHSGKLLQYYNIKTPLLSYHKFNESQREQTVLNRLKQGEIVALISDAGTPGISDPGTELAKLCVDEKIPVVPIPGASAFVAALSASGLATDEFTFVGFLPKHARSRTERLMLSANEVKTQIFYVPPHKLLQFLEETSLLFGYSRYIRYLKILFLFCQL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLVQRLPLMANSLATTGLSKTSWQSRPLLSFLRTQTLLNSLSLYPKINYLLLCSCSQSQTSPDFSNLILEQSSKRGPLEPGLYLVATPIGNLEDITLRALRVLKSANVILSEDTRHSGKLLQYYNIKTPLLSYHKFNESQREQTVLNRLKQGEIVALISDAGTPGISDPGTELAKLCVDEKIPVVPIPGASAFVAALSASGLATDEFTFVGFLPKHARSRTERLMLSANEVKTQIFYVPPHKLLQFLEETSLLFGYSRYIRYLKILFLFCQL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosomal RNA small subunit methyltransferase I Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA.probableP45298
Ribosomal RNA small subunit methyltransferase I Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA.probableQ9CN04
Ribosomal RNA small subunit methyltransferase I Catalyzes the 2'-O-methylation of the ribose of cytidine 1402 (C1402) in 16S rRNA.probableQ9HVZ3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KWP, chain A
Confidence level:very confident
Coverage over the Query: 79-269
View the alignment between query and template
View the model in PyMOL