BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024057
(273 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3R2D|A Chain A, Crystal Structure Of Antitermination Factors Nusb And Nuse
In Complex With Dsrna
pdb|3R2D|B Chain B, Crystal Structure Of Antitermination Factors Nusb And Nuse
In Complex With Dsrna
Length = 149
Score = 28.1 bits (61), Expect = 5.6, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
Query: 97 RAARELALLVVYAACLEGSDPIRLFEKRL---NSRREPGYEFDK 137
+ AR+ A LV+Y L G +P LF++ + N + + YE+ K
Sbjct: 6 KGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAK 49
>pdb|2JR0|A Chain A, Solution Structure Of Nusb From Aquifex Aeolicus
pdb|3R2C|A Chain A, Crystal Structure Of Antitermination Factors Nusb And Nuse
In Complex With Boxa Rna
pdb|3R2C|B Chain B, Crystal Structure Of Antitermination Factors Nusb And Nuse
In Complex With Boxa Rna
pdb|4EYA|A Chain A, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|B Chain B, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|C Chain C, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|D Chain D, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|E Chain E, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|F Chain F, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|G Chain G, Crystal Structure Of A Plectonemic Rna Supercoil
pdb|4EYA|H Chain H, Crystal Structure Of A Plectonemic Rna Supercoil
Length = 148
Score = 28.1 bits (61), Expect = 5.9, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 3/44 (6%)
Query: 97 RAARELALLVVYAACLEGSDPIRLFEKRL---NSRREPGYEFDK 137
+ AR+ A LV+Y L G +P LF++ + N + + YE+ K
Sbjct: 5 KGARDTAFLVLYRWDLRGENPGELFKEVVEEKNIKNKDAYEYAK 48
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.130 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,166,833
Number of Sequences: 62578
Number of extensions: 256228
Number of successful extensions: 591
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 591
Number of HSP's gapped (non-prelim): 2
length of query: 273
length of database: 14,973,337
effective HSP length: 97
effective length of query: 176
effective length of database: 8,903,271
effective search space: 1566975696
effective search space used: 1566975696
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)