Citrus Sinensis ID: 024081

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MGNPKQKWTAEEEEALRAGVAKHGTGKWKNIQRDPEFNPFLFSRSNIDLKDKWRNMSVSAPREKSRTLKPKAGSDAPAVPLSTPQTSALPAAVPIDASADPITDESARSSAPKYNALIFEAISALKEPNGSDVSAILSYIEQRLEVPPNFRRLLSSRLRRLVAQEKLEKVQNCFKVKEDASLGTKTPNPKQKDTRPKLLHSTNDVSPADTVQEAAAAAAGQVADAENKSFVAAEAVKEAERVSRMAEDTDSLLQLAKEIFERCSRGEIVVVA

cccccccccHHHHHHHHHHHHHcccccHHHHHccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEc

******KWTAEEEEALRAGVAKHGTGKWKNIQRDPEFNPFLFSRSNIDLKDKWRNMSV********************************************TDESARSSAPKYNALIFEAISALKEPNGSDVSAILSYIEQRLEVPPNFRRLLSSRLRRLVAQEKLEKVQNCFK****************************************************************ERVSRMAEDTDSLLQLAKEIFERCSRGEIVVVA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGNPKQKWTAEEEEALRAGVAKHGTGKWKNIQRDPEFNPFLFSRSNIDLKDKWRNMSVSAPREKSRTLKPKAGSDAPAVPLSTPQTSALPAAVPIDASADPITDESARSSAPKYNALIFEAISALKEPNGSDVSAILSYIEQRLEVPPNFRRLLSSRLRRLVAQEKLEKVQNCFKVKEDASLGTKTPNPKQKDTRPKLLHSTNDVSPxxxxxxxxxxxxxxxxxxxxxSFVAAEAVKEAERVSRMAEDTDSLLQLAKEIFERCSRGEIVVVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Telomere repeat-binding factor 5	Binds preferentially double-stranded telomeric repeats.	probable	F4IEY4

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZQC, chain A
Confidence level:very confident
Coverage over the Query: 5-75,112-165
View the alignment between query and template
View the model in PyMOL

Template: 2RQP, chain A
Confidence level:confident
Coverage over the Query: 107-180
View the alignment between query and template
View the model in PyMOL