Citrus Sinensis ID: 024091
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| 255541478 | 474 | Glycogen synthase kinase-3 beta, putativ | 1.0 | 0.573 | 0.781 | 1e-124 | |
| 225453724 | 468 | PREDICTED: shaggy-related protein kinase | 0.992 | 0.576 | 0.777 | 1e-123 | |
| 449454478 | 469 | PREDICTED: shaggy-related protein kinase | 0.996 | 0.577 | 0.791 | 1e-121 | |
| 449522286 | 469 | PREDICTED: shaggy-related protein kinase | 0.996 | 0.577 | 0.791 | 1e-121 | |
| 356520459 | 470 | PREDICTED: shaggy-related protein kinase | 1.0 | 0.578 | 0.722 | 1e-116 | |
| 62857012 | 467 | Ser/Thr protein kinase [Lotus japonicus] | 0.988 | 0.576 | 0.722 | 1e-114 | |
| 356504991 | 470 | PREDICTED: shaggy-related protein kinase | 1.0 | 0.578 | 0.711 | 1e-113 | |
| 357507067 | 470 | Shaggy-related protein kinase [Medicago | 1.0 | 0.578 | 0.697 | 1e-112 | |
| 224130108 | 438 | predicted protein [Populus trichocarpa] | 0.875 | 0.543 | 0.803 | 1e-112 | |
| 15236918 | 472 | Shaggy-related protein kinase theta [Ara | 0.992 | 0.572 | 0.721 | 1e-110 |
| >gi|255541478|ref|XP_002511803.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis] gi|223548983|gb|EEF50472.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
Score = 450 bits (1158), Expect = e-124, Method: Compositional matrix adjust.
Identities = 215/275 (78%), Positives = 246/275 (89%), Gaps = 3/275 (1%)
Query: 1 MNVMRRLKSIASGRTSISSDPGGDSGIKRAKVDKELE--VNGEANLVERSASSLEQHMAS 58
MN+MRRLKSIASGRTSISSDPGGDS KR KVD+E E ++GE ER+A+ LEQHMAS
Sbjct: 1 MNMMRRLKSIASGRTSISSDPGGDSLTKRVKVDQETEQKIDGEVYSDERNATGLEQHMAS 60
Query: 59 TSLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEA 118
TSLE ASTS +A+V +TE+SGFDQLPKEM+EMRI+D+K +HD+KD+E +IV+G GTE
Sbjct: 61 TSLENPASTSNSASVVKTEKSGFDQLPKEMHEMRIKDDKTTSHDEKDMEAAIVSGTGTET 120
Query: 119 GQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKN 178
G +IATT+GGRNGQPKQTIS+MAERVVGTGSFGVV+QAKCLETG++VAIKKVLQD+RYKN
Sbjct: 121 GHIIATTLGGRNGQPKQTISFMAERVVGTGSFGVVYQAKCLETGEAVAIKKVLQDRRYKN 180
Query: 179 RELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMN-QHVPI 237
RELQIMRLL HPNVV LKHCF STTEKDELYLNLVLEYI ETVYRVS+HY +MN QH+PI
Sbjct: 181 RELQIMRLLGHPNVVELKHCFISTTEKDELYLNLVLEYIPETVYRVSRHYNKMNHQHMPI 240
Query: 238 LYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272
+YVQLY YQICR L+YLHHVVGVCHRDIKPQNLL+
Sbjct: 241 IYVQLYAYQICRGLSYLHHVVGVCHRDIKPQNLLV 275
|
Source: Ricinus communis Species: Ricinus communis Genus: Ricinus Family: Euphorbiaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225453724|ref|XP_002272112.1| PREDICTED: shaggy-related protein kinase theta isoform 1 [Vitis vinifera] gi|296089061|emb|CBI38764.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|449454478|ref|XP_004144981.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] gi|449473157|ref|XP_004153803.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449522286|ref|XP_004168158.1| PREDICTED: shaggy-related protein kinase theta-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|356520459|ref|XP_003528879.1| PREDICTED: shaggy-related protein kinase theta-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|62857012|dbj|BAD95891.1| Ser/Thr protein kinase [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|356504991|ref|XP_003521276.1| PREDICTED: shaggy-related protein kinase theta [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|357507067|ref|XP_003623822.1| Shaggy-related protein kinase [Medicago truncatula] gi|355498837|gb|AES80040.1| Shaggy-related protein kinase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|224130108|ref|XP_002320754.1| predicted protein [Populus trichocarpa] gi|222861527|gb|EEE99069.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15236918|ref|NP_191981.1| Shaggy-related protein kinase theta [Arabidopsis thaliana] gi|12643793|sp|Q96287.3|KSG8_ARATH RecName: Full=Shaggy-related protein kinase theta; AltName: Full=ASK-theta gi|1944518|emb|CAA69156.1| Shaggy-like kinase tetha [Arabidopsis thaliana] gi|3047105|gb|AAC13616.1| protein kinase [Arabidopsis thaliana] gi|7267411|emb|CAB80881.1| Shaggy related protein kinase tetha [Arabidopsis thaliana] gi|17063158|gb|AAL32976.1| AT4g00720/F6N23_11 [Arabidopsis thaliana] gi|21700933|gb|AAM70590.1| AT4g00720/F6N23_11 [Arabidopsis thaliana] gi|110740517|dbj|BAE98364.1| Shaggy related protein kinase theta [Arabidopsis thaliana] gi|332656525|gb|AEE81925.1| Shaggy-related protein kinase theta [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 272 | ||||||
| TAIR|locus:2126993 | 472 | SK32 "shaggy-like protein kina | 0.992 | 0.572 | 0.688 | 3.3e-95 | |
| TAIR|locus:2832141 | 405 | SK 11 "AT5G26751" [Arabidopsis | 0.742 | 0.498 | 0.708 | 1.1e-78 | |
| TAIR|locus:2222642 | 410 | SK13 "shaggy-like kinase 13" [ | 0.761 | 0.504 | 0.700 | 4.8e-78 | |
| TAIR|locus:2074464 | 409 | ATSK12 [Arabidopsis thaliana ( | 0.757 | 0.503 | 0.695 | 2.7e-77 | |
| TAIR|locus:2098896 | 438 | AT3G61160 [Arabidopsis thalian | 0.794 | 0.493 | 0.640 | 3.2e-72 | |
| TAIR|locus:2052861 | 412 | SKdZeta "SHAGGY-related protei | 0.628 | 0.415 | 0.719 | 2.7e-68 | |
| TAIR|locus:2024341 | 421 | SK41 "shaggy-like protein kina | 0.794 | 0.513 | 0.603 | 4.4e-68 | |
| TAIR|locus:2202255 | 407 | GSK1 "GSK3/SHAGGY-like protein | 0.625 | 0.417 | 0.711 | 1.5e-67 | |
| TAIR|locus:2124082 | 380 | BIN2 "BRASSINOSTEROID-INSENSIT | 0.628 | 0.45 | 0.695 | 8.2e-67 | |
| WB|WBGene00001746 | 362 | gsk-3 [Caenorhabditis elegans | 0.573 | 0.430 | 0.583 | 1.1e-46 |
| TAIR|locus:2126993 SK32 "shaggy-like protein kinase 32" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 947 (338.4 bits), Expect = 3.3e-95, P = 3.3e-95
Identities = 188/273 (68%), Positives = 219/273 (80%)
Query: 1 MNVMRRLKSIASGRTXXXXXXXXXXXXKRAKVDKELE-VNGEANLVERSASSLEQHMAST 59
MNVMRRLKSIASGRT KRAK+D+E + + + V++++S E
Sbjct: 1 MNVMRRLKSIASGRTSISSDPGGDYALKRAKLDQENDNLCVDPMQVDQNSSCFEMKADVL 60
Query: 60 SLEPVASTSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAG 119
S E VA TS V+ E+ DQLP M EM+IRDE+N N +DKD+E ++VNG+GTE G
Sbjct: 61 SQESVAGTSNVPAVS--EKPVDDQLPDVMIEMKIRDERNANREDKDMETTVVNGSGTETG 118
Query: 120 QVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNR 179
QVI TTVGGR+G+PKQTISYMA+RVVGTGSFGVVFQAKCLETG+ VAIKKVLQDKRYKNR
Sbjct: 119 QVITTTVGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNR 178
Query: 180 ELQIMRLLNHPNVVSLKHCFFSTTEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILY 239
ELQIMRL +HPNVV L+H FFSTT+KDELYLNLVLEY+ ETVYR SKHYT+MNQH+PI++
Sbjct: 179 ELQIMRLQDHPNVVRLRHSFFSTTDKDELYLNLVLEYVPETVYRASKHYTKMNQHMPIIF 238
Query: 240 VQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272
VQLYTYQICRALNYLH VVGVCHRDIKPQNLL+
Sbjct: 239 VQLYTYQICRALNYLHRVVGVCHRDIKPQNLLV 271
|
|
| TAIR|locus:2832141 SK 11 "AT5G26751" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2222642 SK13 "shaggy-like kinase 13" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2074464 ATSK12 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2098896 AT3G61160 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2052861 SKdZeta "SHAGGY-related protein kinase dZeta" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2024341 SK41 "shaggy-like protein kinase 41" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2202255 GSK1 "GSK3/SHAGGY-like protein kinase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2124082 BIN2 "BRASSINOSTEROID-INSENSITIVE 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00001746 gsk-3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| PTZ00036 | 440 | PTZ00036, PTZ00036, glycogen synthase kinase; Prov | 7e-47 | |
| smart00220 | 254 | smart00220, S_TKc, Serine/Threonine protein kinase | 1e-34 | |
| pfam00069 | 260 | pfam00069, Pkinase, Protein kinase domain | 3e-33 | |
| cd07834 | 330 | cd07834, STKc_MAPK, Catalytic domain of the Serine | 3e-29 | |
| cd05118 | 283 | cd05118, STKc_CMGC, Catalytic domain of CMGC famil | 4e-29 | |
| cd06606 | 260 | cd06606, STKc_MAPKKK, Catalytic domain of the Prot | 5e-29 | |
| cd00180 | 215 | cd00180, PKc, Catalytic domain of Protein Kinases | 6e-29 | |
| cd07833 | 288 | cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep | 2e-28 | |
| cd07829 | 282 | cd07829, STKc_CDK_like, Catalytic domain of Cyclin | 3e-26 | |
| cd08215 | 258 | cd08215, STKc_Nek, Catalytic domain of the Protein | 2e-25 | |
| cd06627 | 254 | cd06627, STKc_Cdc7_like, Catalytic domain of Cell | 6e-24 | |
| cd07830 | 283 | cd07830, STKc_MAK_like, Catalytic domain of Male g | 8e-24 | |
| cd05122 | 253 | cd05122, PKc_STE, Catalytic domain of STE family P | 3e-23 | |
| cd07832 | 286 | cd07832, STKc_CCRK, Catalytic domain of the Serine | 1e-22 | |
| cd07841 | 298 | cd07841, STKc_CDK7, Catalytic domain of the Serine | 4e-22 | |
| cd06626 | 264 | cd06626, STKc_MEKK4, Catalytic domain of the Prote | 2e-21 | |
| cd07859 | 338 | cd07859, STKc_TDY_MAPK_plant, Catalytic domain of | 5e-21 | |
| cd07831 | 282 | cd07831, STKc_MOK, Catalytic domain of the Serine/ | 6e-21 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 1e-20 | |
| smart00221 | 258 | smart00221, STYKc, Protein kinase; unclassified sp | 3e-20 | |
| cd07851 | 343 | cd07851, STKc_p38, Catalytic domain of the Serine/ | 5e-20 | |
| cd05581 | 280 | cd05581, STKc_PDK1, Catalytic domain of the Protei | 5e-20 | |
| COG0515 | 384 | COG0515, SPS1, Serine/threonine protein kinase [Ge | 8e-20 | |
| cd05123 | 250 | cd05123, STKc_AGC, Catalytic domain of AGC family | 9e-20 | |
| cd07855 | 334 | cd07855, STKc_ERK5, Catalytic domain of the Serine | 1e-19 | |
| cd07835 | 283 | cd07835, STKc_CDK1_like, Catalytic domain of Cycli | 1e-19 | |
| cd07840 | 287 | cd07840, STKc_CDK9_like, Catalytic domain of Cycli | 1e-19 | |
| cd07856 | 328 | cd07856, STKc_Sty1_Hog1, Catalytic domain of the S | 4e-19 | |
| cd07847 | 286 | cd07847, STKc_CDKL1_4, Catalytic domain of the Ser | 1e-18 | |
| smart00219 | 257 | smart00219, TyrKc, Tyrosine kinase, catalytic doma | 4e-18 | |
| cd07849 | 336 | cd07849, STKc_ERK1_2_like, Catalytic domain of Ext | 8e-18 | |
| cd08224 | 267 | cd08224, STKc_Nek6_Nek7, Catalytic domain of the P | 9e-18 | |
| cd06614 | 286 | cd06614, STKc_PAK, Catalytic domain of the Protein | 1e-17 | |
| cd06623 | 264 | cd06623, PKc_MAPKK_plant_like, Catalytic domain of | 2e-17 | |
| cd00192 | 262 | cd00192, PTKc, Catalytic domain of Protein Tyrosin | 2e-17 | |
| cd07860 | 284 | cd07860, STKc_CDK2_3, Catalytic domain of the Seri | 3e-17 | |
| cd07861 | 285 | cd07861, STKc_CDK1_euk, Catalytic domain of the Se | 5e-17 | |
| cd05579 | 265 | cd05579, STKc_MAST_like, Catalytic domain of Micro | 5e-17 | |
| cd07842 | 316 | cd07842, STKc_CDK8_like, Catalytic domain of Cycli | 2e-16 | |
| cd07854 | 342 | cd07854, STKc_MAPK4_6, Catalytic domain of the Ser | 2e-16 | |
| pfam07714 | 258 | pfam07714, Pkinase_Tyr, Protein tyrosine kinase | 2e-16 | |
| cd06610 | 267 | cd06610, STKc_OSR1_SPAK, Catalytic domain of the P | 3e-16 | |
| cd07846 | 286 | cd07846, STKc_CDKL2_3, Catalytic domain of the Ser | 3e-16 | |
| cd07852 | 337 | cd07852, STKc_MAPK15, Catalytic domain of the Seri | 8e-16 | |
| cd07858 | 337 | cd07858, STKc_TEY_MAPK_plant, Catalytic domain of | 8e-16 | |
| cd08229 | 267 | cd08229, STKc_Nek7, Catalytic domain of the Protei | 1e-15 | |
| cd07845 | 309 | cd07845, STKc_CDK10, Catalytic domain of the Serin | 2e-15 | |
| cd07839 | 284 | cd07839, STKc_CDK5, Catalytic domain of the Serine | 2e-15 | |
| cd08217 | 265 | cd08217, STKc_Nek2, Catalytic domain of the Protei | 6e-15 | |
| cd07843 | 293 | cd07843, STKc_CDC2L1, Catalytic domain of the Seri | 7e-15 | |
| cd08228 | 267 | cd08228, STKc_Nek6, Catalytic domain of the Protei | 7e-15 | |
| cd05578 | 258 | cd05578, STKc_Yank1, Catalytic domain of the Prote | 1e-14 | |
| cd06632 | 258 | cd06632, STKc_MEKK1_plant, Catalytic domain of the | 1e-14 | |
| cd06612 | 256 | cd06612, STKc_MST1_2, Catalytic domain of the Prot | 1e-14 | |
| cd07848 | 287 | cd07848, STKc_CDKL5, Catalytic domain of the Serin | 2e-14 | |
| cd06613 | 262 | cd06613, STKc_MAP4K3_like, Catalytic domain of Mit | 2e-14 | |
| cd07838 | 287 | cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc | 3e-14 | |
| cd07879 | 342 | cd07879, STKc_p38delta_MAPK13, Catalytic domain of | 5e-14 | |
| cd06608 | 275 | cd06608, STKc_myosinIII_like, Catalytic domain of | 9e-14 | |
| cd07844 | 291 | cd07844, STKc_PCTAIRE_like, Catalytic domain of PC | 1e-13 | |
| cd05575 | 323 | cd05575, STKc_SGK, Catalytic domain of the Protein | 3e-13 | |
| cd06605 | 265 | cd06605, PKc_MAPKK, Catalytic domain of the dual-s | 3e-13 | |
| cd06629 | 272 | cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain o | 3e-13 | |
| cd07837 | 295 | cd07837, STKc_CdkB_plant, Catalytic domain of the | 4e-13 | |
| cd07853 | 372 | cd07853, STKc_NLK, Catalytic domain of the Serine/ | 6e-13 | |
| cd06609 | 274 | cd06609, STKc_MST3_like, Catalytic domain of Mamma | 8e-13 | |
| cd07865 | 310 | cd07865, STKc_CDK9, Catalytic domain of the Serine | 8e-13 | |
| cd07866 | 311 | cd07866, STKc_BUR1, Catalytic domain of the Serine | 1e-12 | |
| cd07864 | 302 | cd07864, STKc_CDK12, Catalytic domain of the Serin | 1e-12 | |
| cd07880 | 343 | cd07880, STKc_p38gamma_MAPK12, Catalytic domain of | 2e-12 | |
| PLN00009 | 294 | PLN00009, PLN00009, cyclin-dependent kinase A; Pro | 4e-12 | |
| cd06630 | 268 | cd06630, STKc_MEKK1, Catalytic domain of the Prote | 5e-12 | |
| cd07836 | 284 | cd07836, STKc_Pho85, Catalytic domain of the Serin | 5e-12 | |
| cd06607 | 307 | cd06607, STKc_TAO, Catalytic domain of the Protein | 2e-11 | |
| cd05604 | 325 | cd05604, STKc_SGK3, Catalytic domain of the Protei | 2e-11 | |
| cd08221 | 256 | cd08221, STKc_Nek9, Catalytic domain of the Protei | 2e-11 | |
| cd06628 | 267 | cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o | 5e-11 | |
| cd07878 | 343 | cd07878, STKc_p38beta_MAPK11, Catalytic domain of | 6e-11 | |
| cd07850 | 353 | cd07850, STKc_JNK, Catalytic domain of the Serine/ | 8e-11 | |
| cd06648 | 285 | cd06648, STKc_PAK_II, Catalytic domain of the Prot | 1e-10 | |
| PTZ00024 | 335 | PTZ00024, PTZ00024, cyclin-dependent protein kinas | 1e-10 | |
| cd07869 | 303 | cd07869, STKc_PFTAIRE1, Catalytic domain of the Se | 1e-10 | |
| cd06625 | 263 | cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ | 1e-10 | |
| PTZ00426 | 340 | PTZ00426, PTZ00426, cAMP-dependent protein kinase | 2e-10 | |
| cd07877 | 345 | cd07877, STKc_p38alpha_MAPK14, Catalytic domain of | 2e-10 | |
| cd05038 | 284 | cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai | 2e-10 | |
| cd07871 | 288 | cd07871, STKc_PCTAIRE3, Catalytic domain of the Se | 2e-10 | |
| cd07870 | 291 | cd07870, STKc_PFTAIRE2, Catalytic domain of the Se | 2e-10 | |
| cd08530 | 256 | cd08530, STKc_CNK2-like, Catalytic domain of the P | 4e-10 | |
| cd07857 | 332 | cd07857, STKc_MPK1, Catalytic domain of the Serine | 4e-10 | |
| cd07873 | 301 | cd07873, STKc_PCTAIRE1, Catalytic domain of the Se | 6e-10 | |
| cd07862 | 290 | cd07862, STKc_CDK6, Catalytic domain of the Serine | 6e-10 | |
| cd07868 | 317 | cd07868, STKc_CDK8, Catalytic domain of the Serine | 6e-10 | |
| PLN00034 | 353 | PLN00034, PLN00034, mitogen-activated protein kina | 6e-10 | |
| cd05577 | 277 | cd05577, STKc_GRK, Catalytic domain of the Protein | 7e-10 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 1e-09 | |
| cd06917 | 277 | cd06917, STKc_NAK1_like, Catalytic domain of Funga | 1e-09 | |
| cd06658 | 292 | cd06658, STKc_PAK5, Catalytic domain of the Protei | 1e-09 | |
| cd05572 | 262 | cd05572, STKc_cGK_PKG, Catalytic domain of the Pro | 1e-09 | |
| cd07867 | 317 | cd07867, STKc_CDC2L6, Catalytic domain of Serine/T | 1e-09 | |
| cd05582 | 318 | cd05582, STKc_RSK_N, N-terminal catalytic domain o | 1e-09 | |
| cd05611 | 260 | cd05611, STKc_Rim15_like, Catalytic domain of fung | 1e-09 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 2e-09 | |
| cd07872 | 309 | cd07872, STKc_PCTAIRE2, Catalytic domain of the Se | 2e-09 | |
| cd08220 | 256 | cd08220, STKc_Nek8, Catalytic domain of the Protei | 2e-09 | |
| cd05605 | 285 | cd05605, STKc_GRK4_like, Catalytic domain of G pro | 2e-09 | |
| cd05574 | 316 | cd05574, STKc_phototropin_like, Catalytic domain o | 2e-09 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 5e-09 | |
| cd05081 | 284 | cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) | 5e-09 | |
| cd05080 | 283 | cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma | 5e-09 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 6e-09 | |
| cd05622 | 371 | cd05622, STKc_ROCK1, Catalytic domain of the Prote | 9e-09 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 2e-08 | |
| cd05056 | 270 | cd05056, PTKc_FAK, Catalytic domain of the Protein | 2e-08 | |
| cd08528 | 269 | cd08528, STKc_Nek10, Catalytic domain of the Prote | 2e-08 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 2e-08 | |
| cd05046 | 275 | cd05046, PTK_CCK4, Pseudokinase domain of the Prot | 3e-08 | |
| cd05602 | 325 | cd05602, STKc_SGK1, Catalytic domain of the Protei | 3e-08 | |
| cd05609 | 305 | cd05609, STKc_MAST, Catalytic domain of the Protei | 3e-08 | |
| cd07863 | 288 | cd07863, STKc_CDK4, Catalytic domain of the Serine | 4e-08 | |
| cd06634 | 308 | cd06634, STKc_TAO2, Catalytic domain of the Protei | 4e-08 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 5e-08 | |
| cd06633 | 313 | cd06633, STKc_TAO3, Catalytic domain of the Protei | 5e-08 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 5e-08 | |
| cd06635 | 317 | cd06635, STKc_TAO1, Catalytic domain of the Protei | 6e-08 | |
| cd06645 | 267 | cd06645, STKc_MAP4K3, Catalytic domain of the Prot | 6e-08 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 1e-07 | |
| cd05603 | 321 | cd05603, STKc_SGK2, Catalytic domain of the Protei | 1e-07 | |
| cd08218 | 256 | cd08218, STKc_Nek1, Catalytic domain of the Protei | 1e-07 | |
| cd06653 | 264 | cd06653, STKc_MEKK3_like_1, Catalytic domain of MA | 1e-07 | |
| cd06657 | 292 | cd06657, STKc_PAK4, Catalytic domain of the Protei | 1e-07 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 1e-07 | |
| cd07876 | 359 | cd07876, STKc_JNK2, Catalytic domain of the Serine | 2e-07 | |
| cd06618 | 296 | cd06618, PKc_MKK7, Catalytic domain of the dual-sp | 2e-07 | |
| cd06617 | 283 | cd06617, PKc_MKK3_6, Catalytic domain of the dual- | 3e-07 | |
| cd06647 | 293 | cd06647, STKc_PAK_I, Catalytic domain of the Prote | 3e-07 | |
| cd05632 | 285 | cd05632, STKc_GRK5, Catalytic domain of the Protei | 4e-07 | |
| cd08225 | 257 | cd08225, STKc_Nek5, Catalytic domain of the Protei | 4e-07 | |
| cd06616 | 288 | cd06616, PKc_MKK4, Catalytic domain of the dual-sp | 4e-07 | |
| cd05588 | 329 | cd05588, STKc_aPKC, Catalytic domain of the Protei | 5e-07 | |
| cd08223 | 257 | cd08223, STKc_Nek4, Catalytic domain of the Protei | 5e-07 | |
| cd08529 | 256 | cd08529, STKc_FA2-like, Catalytic domain of the Pr | 6e-07 | |
| cd08219 | 255 | cd08219, STKc_Nek3, Catalytic domain of the Protei | 6e-07 | |
| cd05607 | 277 | cd05607, STKc_GRK7, Catalytic domain of the Protei | 7e-07 | |
| cd05630 | 285 | cd05630, STKc_GRK6, Catalytic domain of the Protei | 7e-07 | |
| cd05629 | 377 | cd05629, STKc_NDR_like_fungal, Catalytic domain of | 8e-07 | |
| cd05049 | 280 | cd05049, PTKc_Trk, Catalytic domain of the Protein | 9e-07 | |
| cd05617 | 327 | cd05617, STKc_aPKC_zeta, Catalytic domain of the P | 9e-07 | |
| cd06621 | 287 | cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of | 9e-07 | |
| cd07874 | 355 | cd07874, STKc_JNK3, Catalytic domain of the Serine | 1e-06 | |
| cd06651 | 266 | cd06651, STKc_MEKK3, Catalytic domain of the Prote | 1e-06 | |
| cd06644 | 292 | cd06644, STKc_STK10_LOK, Catalytic domain of the P | 2e-06 | |
| cd06631 | 265 | cd06631, STKc_YSK4, Catalytic domain of the Protei | 2e-06 | |
| cd05618 | 329 | cd05618, STKc_aPKC_iota, Catalytic domain of the P | 2e-06 | |
| cd06652 | 265 | cd06652, STKc_MEKK2, Catalytic domain of the Prote | 2e-06 | |
| cd08216 | 314 | cd08216, PK_STRAD, Pseudokinase domain of STE20-re | 2e-06 | |
| cd06655 | 296 | cd06655, STKc_PAK2, Catalytic domain of the Protei | 2e-06 | |
| cd05040 | 257 | cd05040, PTKc_Ack_like, Catalytic domain of the Pr | 3e-06 | |
| cd06624 | 268 | cd06624, STKc_ASK, Catalytic domain of the Protein | 3e-06 | |
| cd05060 | 257 | cd05060, PTKc_Syk_like, Catalytic domain of Spleen | 3e-06 | |
| cd05613 | 290 | cd05613, STKc_MSK1_N, N-terminal catalytic domain | 5e-06 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 5e-06 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 7e-06 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 7e-06 | |
| PHA03212 | 391 | PHA03212, PHA03212, serine/threonine kinase US3; P | 7e-06 | |
| cd07875 | 364 | cd07875, STKc_JNK1, Catalytic domain of the Serine | 8e-06 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 1e-05 | |
| cd05583 | 288 | cd05583, STKc_MSK_N, N-terminal catalytic domain o | 1e-05 | |
| cd06659 | 297 | cd06659, STKc_PAK6, Catalytic domain of the Protei | 1e-05 | |
| cd06611 | 280 | cd06611, STKc_SLK_like, Catalytic domain of Ste20- | 1e-05 | |
| cd06646 | 267 | cd06646, STKc_MAP4K5, Catalytic domain of the Prot | 2e-05 | |
| cd05631 | 285 | cd05631, STKc_GRK4, Catalytic domain of the Protei | 3e-05 | |
| cd06656 | 297 | cd06656, STKc_PAK3, Catalytic domain of the Protei | 3e-05 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 3e-05 | |
| cd05079 | 284 | cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) doma | 3e-05 | |
| PRK13184 | 932 | PRK13184, pknD, serine/threonine-protein kinase; R | 3e-05 | |
| cd06643 | 282 | cd06643, STKc_SLK, Catalytic domain of the Protein | 4e-05 | |
| PHA03390 | 267 | PHA03390, pk1, serine/threonine-protein kinase 1; | 5e-05 | |
| cd05608 | 280 | cd05608, STKc_GRK1, Catalytic domain of the Protei | 6e-05 | |
| cd06639 | 291 | cd06639, STKc_myosinIIIB, Catalytic domain of the | 8e-05 | |
| cd05039 | 256 | cd05039, PTKc_Csk_like, Catalytic domain of C-term | 9e-05 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 9e-05 | |
| cd06654 | 296 | cd06654, STKc_PAK1, Catalytic domain of the Protei | 1e-04 | |
| cd08227 | 327 | cd08227, PK_STRAD_alpha, Pseudokinase domain of ST | 1e-04 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 1e-04 | |
| cd05586 | 330 | cd05586, STKc_Sck1_like, Catalytic domain of Suppr | 1e-04 | |
| PHA03209 | 357 | PHA03209, PHA03209, serine/threonine kinase US3; P | 1e-04 | |
| cd06638 | 286 | cd06638, STKc_myosinIIIA, Catalytic domain of the | 2e-04 | |
| cd06620 | 284 | cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of | 3e-04 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 3e-04 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 3e-04 | |
| cd05048 | 283 | cd05048, PTKc_Ror, Catalytic Domain of the Protein | 3e-04 | |
| cd05626 | 381 | cd05626, STKc_LATS2, Catalytic domain of the Prote | 3e-04 | |
| cd06615 | 308 | cd06615, PKc_MEK, Catalytic domain of the dual-spe | 4e-04 | |
| cd06636 | 282 | cd06636, STKc_MAP4K4_6, Catalytic domain of the Pr | 4e-04 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 5e-04 | |
| cd05057 | 279 | cd05057, PTKc_EGFR_like, Catalytic domain of Epide | 6e-04 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 7e-04 | |
| cd05623 | 332 | cd05623, STKc_MRCK_alpha, Catalytic domain of the | 8e-04 | |
| PTZ00266 | 1021 | PTZ00266, PTZ00266, NIMA-related protein kinase; P | 8e-04 | |
| TIGR03903 | 1266 | TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclas | 9e-04 | |
| cd05108 | 316 | cd05108, PTKc_EGFR, Catalytic domain of the Protei | 0.001 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 0.001 | |
| cd05610 | 669 | cd05610, STKc_MASTL, Catalytic domain of the Prote | 0.001 | |
| cd06650 | 333 | cd06650, PKc_MEK1, Catalytic domain of the dual-sp | 0.002 | |
| cd05058 | 262 | cd05058, PTKc_Met_Ron, Catalytic domain of the Pro | 0.002 | |
| cd05606 | 278 | cd05606, STKc_beta_ARK, Catalytic domain of the Pr | 0.002 | |
| cd05034 | 261 | cd05034, PTKc_Src_like, Catalytic domain of Src ki | 0.002 | |
| cd05625 | 382 | cd05625, STKc_LATS1, Catalytic domain of the Prote | 0.002 | |
| cd05633 | 279 | cd05633, STKc_GRK3, Catalytic domain of the Protei | 0.003 | |
| cd06622 | 286 | cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of | 0.003 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 0.003 | |
| PHA03207 | 392 | PHA03207, PHA03207, serine/threonine kinase US3; P | 0.003 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 0.003 | |
| cd06649 | 331 | cd06649, PKc_MEK2, Catalytic domain of the dual-sp | 0.003 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 0.004 | |
| cd06637 | 272 | cd06637, STKc_TNIK, Catalytic domain of the Protei | 0.004 |
| >gnl|CDD|173333 PTZ00036, PTZ00036, glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
Score = 161 bits (409), Expect = 7e-47
Identities = 76/164 (46%), Positives = 110/164 (67%), Gaps = 6/164 (3%)
Query: 112 NGNGTEAGQVIATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVL 171
N N E N P + SY ++G GSFGVV++A C++T + VAIKKVL
Sbjct: 43 NNNAGEDEDEEKMIDNDINRSPNK--SYKLGNIIGNGSFGVVYEAICIDTSEKVAIKKVL 100
Query: 172 QDKRYKNRELQIMRLLNHPNVVSLKHCFFSTT-EKDE--LYLNLVLEYISETVYRVSKHY 228
QD +YKNREL IM+ LNH N++ LK +++ +K+E ++LN+V+E+I +TV++ KHY
Sbjct: 101 QDPQYKNRELLIMKNLNHINIIFLKDYYYTECFKKNEKNIFLNVVMEFIPQTVHKYMKHY 160
Query: 229 TRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272
R N +P+ V+LY+YQ+CRAL Y+H +CHRD+KPQNLL+
Sbjct: 161 ARNNHALPLFLVKLYSYQLCRALAYIHSKF-ICHRDLKPQNLLI 203
|
Length = 440 |
| >gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain | Back alignment and domain information |
|---|
| >gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|143364 cd07859, STKc_TDY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|173735 cd07831, STKc_MOK, Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143361 cd07856, STKc_Sty1_Hog1, Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >gnl|CDD|173744 cd07847, STKc_CDKL1_4, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|143354 cd07849, STKc_ERK1_2_like, Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173764 cd08224, STKc_Nek6_Nek7, Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173740 cd07842, STKc_CDK8_like, Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173743 cd07846, STKc_CDKL2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173747 cd07852, STKc_MAPK15, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >gnl|CDD|173769 cd08229, STKc_Nek7, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173741 cd07843, STKc_CDC2L1, Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173768 cd08228, STKc_Nek6, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173745 cd07848, STKc_CDKL5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143384 cd07879, STKc_p38delta_MAPK13, Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143349 cd07844, STKc_PCTAIRE_like, Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173666 cd05575, STKc_SGK, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173723 cd06605, PKc_MAPKK, Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132960 cd06629, STKc_MAPKKK_Bck1_like, Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143342 cd07837, STKc_CdkB_plant, Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173748 cd07853, STKc_NLK, Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|143371 cd07866, STKc_BUR1, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173753 cd07864, STKc_CDK12, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >gnl|CDD|143385 cd07880, STKc_p38gamma_MAPK12, Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|177649 PLN00009, PLN00009, cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132961 cd06630, STKc_MEKK1, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|143341 cd07836, STKc_Pho85, Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >gnl|CDD|173695 cd05604, STKc_SGK3, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143383 cd07878, STKc_p38beta_MAPK11, Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173746 cd07850, STKc_JNK, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|240233 PTZ00024, PTZ00024, cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143374 cd07869, STKc_PFTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173616 PTZ00426, PTZ00426, cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143382 cd07877, STKc_p38alpha_MAPK14, Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143376 cd07871, STKc_PCTAIRE3, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143375 cd07870, STKc_PFTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173750 cd07857, STKc_MPK1, Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >gnl|CDD|143378 cd07873, STKc_PCTAIRE1, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143367 cd07862, STKc_CDK6, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|143373 cd07868, STKc_CDK8, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143372 cd07867, STKc_CDC2L6, Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143377 cd07872, STKc_PCTAIRE2, Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >gnl|CDD|173696 cd05605, STKc_GRK4_like, Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173712 cd05622, STKc_ROCK1, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133187 cd05056, PTKc_FAK, Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173693 cd05602, STKc_SGK1, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143368 cd07863, STKc_CDK4, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132965 cd06634, STKc_TAO2, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132964 cd06633, STKc_TAO3, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|132966 cd06635, STKc_TAO1, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132976 cd06645, STKc_MAP4K3, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173694 cd05603, STKc_SGK2, Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132984 cd06653, STKc_MEKK3_like_1, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|143381 cd07876, STKc_JNK2, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132949 cd06618, PKc_MKK7, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132978 cd06647, STKc_PAK_I, Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173721 cd05632, STKc_GRK5, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|132947 cd06616, PKc_MKK4, Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173679 cd05588, STKc_aPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173763 cd08223, STKc_Nek4, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >gnl|CDD|173719 cd05630, STKc_GRK6, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173708 cd05617, STKc_aPKC_zeta, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >gnl|CDD|132952 cd06621, PKc_MAPKK_Pek1_like, Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|143379 cd07874, STKc_JNK3, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132982 cd06651, STKc_MEKK3, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132975 cd06644, STKc_STK10_LOK, Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|88519 cd05618, STKc_aPKC_iota, Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >gnl|CDD|132983 cd06652, STKc_MEKK2, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173756 cd08216, PK_STRAD, Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >gnl|CDD|132986 cd06655, STKc_PAK2, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|133172 cd05040, PTKc_Ack_like, Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >gnl|CDD|133191 cd05060, PTKc_Syk_like, Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173704 cd05613, STKc_MSK1_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|165478 PHA03212, PHA03212, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|143380 cd07875, STKc_JNK1, Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|132977 cd06646, STKc_MAP4K5, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >gnl|CDD|173720 cd05631, STKc_GRK4, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >gnl|CDD|132987 cd06656, STKc_PAK3, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173644 cd05079, PTKc_Jak1_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|183880 PRK13184, pknD, serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|132974 cd06643, STKc_SLK, Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173699 cd05608, STKc_GRK1, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|132970 cd06639, STKc_myosinIIIB, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|132985 cd06654, STKc_PAK1, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173767 cd08227, PK_STRAD_alpha, Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|177557 PHA03209, PHA03209, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|132969 cd06638, STKc_myosinIIIA, Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >gnl|CDD|132951 cd06620, PKc_MAPKK_Byr1_like, Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >gnl|CDD|132946 cd06615, PKc_MEK, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132967 cd06636, STKc_MAP4K4_6, Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|173636 cd05057, PTKc_EGFR_like, Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|88524 cd05623, STKc_MRCK_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234389 TIGR03903, TOMM_kin_cyc, TOMM system kinase/cyclase fusion protein | Back alignment and domain information |
|---|
| >gnl|CDD|173654 cd05108, PTKc_EGFR, Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173701 cd05610, STKc_MASTL, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >gnl|CDD|132981 cd06650, PKc_MEK1, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|133189 cd05058, PTKc_Met_Ron, Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >gnl|CDD|132953 cd06622, PKc_MAPKK_PBS2_like, Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|165473 PHA03207, PHA03207, serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >gnl|CDD|132980 cd06649, PKc_MEK2, Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 99.98 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 99.98 | |
| KOG0615 | 475 | consensus Serine/threonine protein kinase Chk2 and | 99.97 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 99.96 | |
| KOG0593 | 396 | consensus Predicted protein kinase KKIAMRE [Genera | 99.96 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 99.96 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 99.96 | |
| KOG1290 | 590 | consensus Serine/threonine protein kinase [Signal | 99.96 | |
| KOG0598 | 357 | consensus Ribosomal protein S6 kinase and related | 99.95 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 99.95 | |
| KOG0592 | 604 | consensus 3-phosphoinositide-dependent protein kin | 99.95 | |
| KOG0659 | 318 | consensus Cdk activating kinase (CAK)/RNA polymera | 99.95 | |
| KOG0610 | 459 | consensus Putative serine/threonine protein kinase | 99.95 | |
| KOG0585 | 576 | consensus Ca2+/calmodulin-dependent protein kinase | 99.95 | |
| KOG0583 | 370 | consensus Serine/threonine protein kinase [Signal | 99.94 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 99.94 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 99.94 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 99.94 | |
| KOG0616 | 355 | consensus cAMP-dependent protein kinase catalytic | 99.94 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 99.94 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 99.94 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 99.94 | |
| KOG0597 | 808 | consensus Serine-threonine protein kinase FUSED [G | 99.93 | |
| KOG0582 | 516 | consensus Ste20-like serine/threonine protein kina | 99.93 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 99.93 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 99.93 | |
| KOG0611 | 668 | consensus Predicted serine/threonine protein kinas | 99.93 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 99.93 | |
| KOG0588 | 786 | consensus Serine/threonine protein kinase [Cell cy | 99.93 | |
| cd07859 | 338 | STKc_TDY_MAPK_plant Catalytic domain of the Serine | 99.93 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 99.93 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 99.93 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 99.93 | |
| cd07869 | 303 | STKc_PFTAIRE1 Catalytic domain of the Serine/Threo | 99.92 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 99.92 | |
| cd07871 | 288 | STKc_PCTAIRE3 Catalytic domain of the Serine/Threo | 99.92 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 99.92 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 99.92 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 99.92 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 99.92 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 99.92 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 99.92 | |
| PTZ00284 | 467 | protein kinase; Provisional | 99.92 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 99.92 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 99.92 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 99.91 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 99.91 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 99.91 | |
| KOG1989 | 738 | consensus ARK protein kinase family [Signal transd | 99.91 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 99.91 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 99.91 | |
| cd07848 | 287 | STKc_CDKL5 Catalytic domain of the Serine/Threonin | 99.91 | |
| KOG0660 | 359 | consensus Mitogen-activated protein kinase [Signal | 99.91 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 99.91 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 99.91 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 99.91 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 99.91 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 99.91 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 99.91 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 99.91 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 99.91 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 99.91 | |
| cd07872 | 309 | STKc_PCTAIRE2 Catalytic domain of the Serine/Threo | 99.91 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 99.91 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 99.91 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 99.91 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 99.91 | |
| cd07863 | 288 | STKc_CDK4 Catalytic domain of the Serine/Threonine | 99.91 | |
| cd07853 | 372 | STKc_NLK Catalytic domain of the Serine/Threonine | 99.91 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 99.9 | |
| KOG0662 | 292 | consensus Cyclin-dependent kinase CDK5 [Intracellu | 99.9 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 99.9 | |
| cd07862 | 290 | STKc_CDK6 Catalytic domain of the Serine/Threonine | 99.9 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 99.9 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 99.9 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 99.9 | |
| KOG0586 | 596 | consensus Serine/threonine protein kinase [General | 99.9 | |
| cd05064 | 266 | PTKc_EphR_A10 Catalytic domain of the Protein Tyro | 99.9 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 99.9 | |
| KOG4717 | 864 | consensus Serine/threonine protein kinase [Signal | 99.9 | |
| PHA03207 | 392 | serine/threonine kinase US3; Provisional | 99.9 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 99.9 | |
| cd05610 | 669 | STKc_MASTL Catalytic domain of the Protein Serine/ | 99.9 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 99.9 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 99.9 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 99.9 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 99.9 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 99.9 | |
| cd05096 | 304 | PTKc_DDR1 Catalytic domain of the Protein Tyrosine | 99.9 | |
| cd07873 | 301 | STKc_PCTAIRE1 Catalytic domain of the Serine/Threo | 99.9 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 99.9 | |
| KOG2345 | 302 | consensus Serine/threonine protein kinase/TGF-beta | 99.9 | |
| KOG0589 | 426 | consensus Serine/threonine protein kinase [General | 99.9 | |
| cd06649 | 331 | PKc_MEK2 Catalytic domain of the dual-specificity | 99.9 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 99.9 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 99.89 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 99.89 | |
| cd07868 | 317 | STKc_CDK8 Catalytic domain of the Serine/Threonine | 99.89 | |
| cd07842 | 316 | STKc_CDK8_like Catalytic domain of Cyclin-Dependen | 99.89 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 99.89 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 99.89 | |
| PF00069 | 260 | Pkinase: Protein kinase domain Protein kinase; unc | 99.89 | |
| cd07861 | 285 | STKc_CDK1_euk Catalytic domain of the Serine/Threo | 99.89 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 99.89 | |
| cd06650 | 333 | PKc_MEK1 Catalytic domain of the dual-specificity | 99.89 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 99.89 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 99.89 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 99.89 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 99.89 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 99.89 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 99.89 | |
| cd08227 | 327 | PK_STRAD_alpha Pseudokinase domain of STE20-relate | 99.89 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 99.89 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 99.89 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 99.89 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 99.89 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 99.89 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 99.89 | |
| cd07844 | 291 | STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like | 99.89 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 99.89 | |
| cd08228 | 267 | STKc_Nek6 Catalytic domain of the Protein Serine/T | 99.89 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 99.89 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 99.89 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 99.89 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 99.89 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 99.89 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 99.89 | |
| cd07837 | 295 | STKc_CdkB_plant Catalytic domain of the Serine/Thr | 99.89 | |
| cd07870 | 291 | STKc_PFTAIRE2 Catalytic domain of the Serine/Threo | 99.89 | |
| cd07839 | 284 | STKc_CDK5 Catalytic domain of the Serine/Threonine | 99.89 | |
| KOG0033 | 355 | consensus Ca2+/calmodulin-dependent protein kinase | 99.89 | |
| PRK13184 | 932 | pknD serine/threonine-protein kinase; Reviewed | 99.89 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 99.89 | |
| cd06617 | 283 | PKc_MKK3_6 Catalytic domain of the dual-specificit | 99.89 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 99.89 | |
| cd07847 | 286 | STKc_CDKL1_4 Catalytic domain of the Serine/Threon | 99.89 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 99.88 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 99.88 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 99.88 | |
| cd06615 | 308 | PKc_MEK Catalytic domain of the dual-specificity P | 99.88 | |
| cd07836 | 284 | STKc_Pho85 Catalytic domain of the Serine/Threonin | 99.88 | |
| KOG0666 | 438 | consensus Cyclin C-dependent kinase CDK8 [Transcri | 99.88 | |
| cd07867 | 317 | STKc_CDC2L6 Catalytic domain of Serine/Threonine K | 99.88 | |
| cd07841 | 298 | STKc_CDK7 Catalytic domain of the Serine/Threonine | 99.88 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 99.88 | |
| KOG0607 | 463 | consensus MAP kinase-interacting kinase and relate | 99.88 | |
| cd08224 | 267 | STKc_Nek6_Nek7 Catalytic domain of the Protein Ser | 99.88 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 99.88 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 99.88 | |
| cd07849 | 336 | STKc_ERK1_2_like Catalytic domain of Extracellular | 99.88 | |
| KOG0578 | 550 | consensus p21-activated serine/threonine protein k | 99.88 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 99.88 | |
| cd06619 | 279 | PKc_MKK5 Catalytic domain of the dual-specificity | 99.88 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 99.88 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 99.88 | |
| cd05081 | 284 | PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of | 99.88 | |
| cd06630 | 268 | STKc_MEKK1 Catalytic domain of the Protein Serine/ | 99.88 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 99.88 | |
| cd06625 | 263 | STKc_MEKK3_like Catalytic domain of MAP/ERK kinase | 99.88 | |
| cd07832 | 286 | STKc_CCRK Catalytic domain of the Serine/Threonine | 99.87 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 99.87 | |
| cd05076 | 274 | PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th | 99.87 | |
| cd06622 | 286 | PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS | 99.87 | |
| PLN00009 | 294 | cyclin-dependent kinase A; Provisional | 99.87 | |
| cd05084 | 252 | PTKc_Fes Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd07858 | 337 | STKc_TEY_MAPK_plant Catalytic domain of the Serine | 99.87 | |
| cd08219 | 255 | STKc_Nek3 Catalytic domain of the Protein Serine/T | 99.87 | |
| KOG1152 | 772 | consensus Signal transduction serine/threonine kin | 99.87 | |
| cd05066 | 267 | PTKc_EphR_A Catalytic domain of the Protein Tyrosi | 99.87 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 99.87 | |
| cd08229 | 267 | STKc_Nek7 Catalytic domain of the Protein Serine/T | 99.87 | |
| cd05088 | 303 | PTKc_Tie2 Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 99.87 | |
| cd06652 | 265 | STKc_MEKK2 Catalytic domain of the Protein Serine/ | 99.87 | |
| cd05046 | 275 | PTK_CCK4 Pseudokinase domain of the Protein Tyrosi | 99.87 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 99.87 | |
| cd05609 | 305 | STKc_MAST Catalytic domain of the Protein Serine/T | 99.87 | |
| cd07860 | 284 | STKc_CDK2_3 Catalytic domain of the Serine/Threoni | 99.87 | |
| cd06608 | 275 | STKc_myosinIII_like Catalytic domain of Class III | 99.87 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 99.87 | |
| KOG0612 | 1317 | consensus Rho-associated, coiled-coil containing p | 99.87 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 99.87 | |
| cd06611 | 280 | STKc_SLK_like Catalytic domain of Ste20-like kinas | 99.87 | |
| cd07855 | 334 | STKc_ERK5 Catalytic domain of the Serine/Threonine | 99.87 | |
| cd07854 | 342 | STKc_MAPK4_6 Catalytic domain of the Serine/Threon | 99.87 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 99.87 | |
| cd05114 | 256 | PTKc_Tec_Rlk Catalytic domain of the Protein Tyros | 99.87 | |
| cd07846 | 286 | STKc_CDKL2_3 Catalytic domain of the Serine/Threon | 99.87 | |
| cd05574 | 316 | STKc_phototropin_like Catalytic domain of Phototro | 99.87 | |
| cd05578 | 258 | STKc_Yank1 Catalytic domain of the Protein Serine/ | 99.87 | |
| cd08226 | 328 | PK_STRAD_beta Pseudokinase domain of STE20-related | 99.87 | |
| cd05035 | 273 | PTKc_Axl_like Catalytic Domain of Axl-like Protein | 99.87 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 99.87 | |
| cd05052 | 263 | PTKc_Abl Catalytic domain of the Protein Tyrosine | 99.87 | |
| cd05065 | 269 | PTKc_EphR_B Catalytic domain of the Protein Tyrosi | 99.86 | |
| cd05090 | 283 | PTKc_Ror1 Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd06628 | 267 | STKc_MAPKKK_Byr2_like Catalytic domain of fungal B | 99.86 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 99.86 | |
| cd05075 | 272 | PTKc_Axl Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd06613 | 262 | STKc_MAP4K3_like Catalytic domain of Mitogen-activ | 99.86 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 99.86 | |
| cd05032 | 277 | PTKc_InsR_like Catalytic domain of Insulin Recepto | 99.86 | |
| cd05033 | 266 | PTKc_EphR Catalytic domain of Ephrin Receptor Prot | 99.86 | |
| cd06629 | 272 | STKc_MAPKKK_Bck1_like Catalytic domain of fungal B | 99.86 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 99.86 | |
| cd05061 | 288 | PTKc_InsR Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 99.86 | |
| cd07843 | 293 | STKc_CDC2L1 Catalytic domain of the Serine/Threoni | 99.86 | |
| cd06631 | 265 | STKc_YSK4 Catalytic domain of the Protein Serine/T | 99.86 | |
| cd06621 | 287 | PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek | 99.86 | |
| cd05062 | 277 | PTKc_IGF-1R Catalytic domain of the Protein Tyrosi | 99.86 | |
| cd05113 | 256 | PTKc_Btk_Bmx Catalytic domain of the Protein Tyros | 99.86 | |
| cd05051 | 296 | PTKc_DDR Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 99.86 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 99.86 | |
| cd05068 | 261 | PTKc_Frk_like Catalytic domain of Fyn-related kina | 99.86 | |
| cd05077 | 262 | PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th | 99.86 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 99.86 | |
| cd06653 | 264 | STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina | 99.86 | |
| cd05079 | 284 | PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the | 99.86 | |
| KOG0579 | 1187 | consensus Ste20-like serine/threonine protein kina | 99.86 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 99.86 | |
| cd08221 | 256 | STKc_Nek9 Catalytic domain of the Protein Serine/T | 99.86 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 99.86 | |
| cd08529 | 256 | STKc_FA2-like Catalytic domain of the Protein Seri | 99.86 | |
| cd06632 | 258 | STKc_MEKK1_plant Catalytic domain of the Protein S | 99.86 | |
| cd07831 | 282 | STKc_MOK Catalytic domain of the Serine/Threonine | 99.86 | |
| cd08217 | 265 | STKc_Nek2 Catalytic domain of the Protein Serine/T | 99.86 | |
| cd06643 | 282 | STKc_SLK Catalytic domain of the Protein Serine/Th | 99.86 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 99.86 | |
| cd05080 | 283 | PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the | 99.86 | |
| cd05095 | 296 | PTKc_DDR2 Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd06637 | 272 | STKc_TNIK Catalytic domain of the Protein Serine/T | 99.86 | |
| cd07833 | 288 | STKc_CDKL Catalytic domain of Cyclin-Dependent pro | 99.86 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd06651 | 266 | STKc_MEKK3 Catalytic domain of the Protein Serine/ | 99.86 | |
| cd05148 | 261 | PTKc_Srm_Brk Catalytic domain of the Protein Tyros | 99.86 | |
| cd06620 | 284 | PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr | 99.86 | |
| cd05072 | 261 | PTKc_Lyn Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd05059 | 256 | PTKc_Tec_like Catalytic domain of Tec-like Protein | 99.86 | |
| cd05097 | 295 | PTKc_DDR_like Catalytic domain of Discoidin Domain | 99.86 | |
| cd05093 | 288 | PTKc_TrkB Catalytic domain of the Protein Tyrosine | 99.86 | |
| cd05037 | 259 | PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the | 99.86 | |
| cd08223 | 257 | STKc_Nek4 Catalytic domain of the Protein Serine/T | 99.86 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 99.86 | |
| cd05036 | 277 | PTKc_ALK_LTK Catalytic domain of the Protein Tyros | 99.85 | |
| cd05089 | 297 | PTKc_Tie1 Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd05045 | 290 | PTKc_RET Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd05042 | 269 | PTKc_Aatyk Catalytic domain of the Protein Tyrosin | 99.85 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 99.85 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 99.85 | |
| cd05063 | 268 | PTKc_EphR_A2 Catalytic domain of the Protein Tyros | 99.85 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 99.85 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 99.85 | |
| cd07835 | 283 | STKc_CDK1_like Catalytic domain of Cyclin-Dependen | 99.85 | |
| cd06610 | 267 | STKc_OSR1_SPAK Catalytic domain of the Protein Ser | 99.85 | |
| cd05039 | 256 | PTKc_Csk_like Catalytic domain of C-terminal Src k | 99.85 | |
| cd05147 | 190 | RIO1_euk RIO kinase family; eukaryotic RIO1, catal | 99.85 | |
| cd08220 | 256 | STKc_Nek8 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 99.85 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 99.85 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 99.85 | |
| cd05100 | 334 | PTKc_FGFR3 Catalytic domain of the Protein Tyrosin | 99.85 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 99.85 | |
| KOG0671 | 415 | consensus LAMMER dual specificity kinases [Signal | 99.85 | |
| KOG4721 | 904 | consensus Serine/threonine protein kinase, contain | 99.85 | |
| cd05050 | 288 | PTKc_Musk Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd05071 | 262 | PTKc_Src Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd06626 | 264 | STKc_MEKK4 Catalytic domain of the Protein Serine/ | 99.85 | |
| cd05049 | 280 | PTKc_Trk Catalytic domain of the Protein Tyrosine | 99.85 | |
| cd07857 | 332 | STKc_MPK1 Catalytic domain of the Serine/Threonine | 99.85 | |
| cd08218 | 256 | STKc_Nek1 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd05078 | 258 | PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain | 99.85 | |
| cd07834 | 330 | STKc_MAPK Catalytic domain of the Serine/Threonine | 99.85 | |
| cd06641 | 277 | STKc_MST3 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd05048 | 283 | PTKc_Ror Catalytic Domain of the Protein Tyrosine | 99.85 | |
| cd08225 | 257 | STKc_Nek5 Catalytic domain of the Protein Serine/T | 99.85 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 99.85 | |
| PHA03210 | 501 | serine/threonine kinase US3; Provisional | 99.85 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 99.85 | |
| cd05087 | 269 | PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein | 99.85 | |
| KOG0604 | 400 | consensus MAP kinase-activated protein kinase 2 [S | 99.85 | |
| cd05034 | 261 | PTKc_Src_like Catalytic domain of Src kinase-like | 99.85 | |
| KOG0584 | 632 | consensus Serine/threonine protein kinase [General | 99.85 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 99.85 | |
| cd05613 | 290 | STKc_MSK1_N N-terminal catalytic domain of the Pro | 99.84 | |
| KOG1163 | 341 | consensus Casein kinase (serine/threonine/tyrosine | 99.84 | |
| cd07840 | 287 | STKc_CDK9_like Catalytic domain of Cyclin-Dependen | 99.84 | |
| cd05067 | 260 | PTKc_Lck_Blk Catalytic domain of the Protein Tyros | 99.84 | |
| cd06642 | 277 | STKc_STK25-YSK1 Catalytic domain of the Protein Se | 99.84 | |
| cd05091 | 283 | PTKc_Ror2 Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd05082 | 256 | PTKc_Csk Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd05086 | 268 | PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi | 99.84 | |
| KOG0668 | 338 | consensus Casein kinase II, alpha subunit [Signal | 99.84 | |
| cd05115 | 257 | PTKc_Zap-70 Catalytic domain of the Protein Tyrosi | 99.84 | |
| cd05094 | 291 | PTKc_TrkC Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd05038 | 284 | PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P | 99.84 | |
| cd05112 | 256 | PTKc_Itk Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd06616 | 288 | PKc_MKK4 Catalytic domain of the dual-specificity | 99.84 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 99.84 | |
| cd00192 | 262 | PTKc Catalytic domain of Protein Tyrosine Kinases. | 99.84 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 99.84 | |
| KOG0599 | 411 | consensus Phosphorylase kinase gamma subunit [Carb | 99.84 | |
| cd07830 | 283 | STKc_MAK_like Catalytic domain of Male germ cell-A | 99.84 | |
| cd08222 | 260 | STKc_Nek11 Catalytic domain of the Protein Serine/ | 99.84 | |
| cd05043 | 280 | PTK_Ryk Pseudokinase domain of Ryk (Receptor relat | 99.84 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 99.84 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd08215 | 258 | STKc_Nek Catalytic domain of the Protein Serine/Th | 99.84 | |
| cd06640 | 277 | STKc_MST4 Catalytic domain of the Protein Serine/T | 99.84 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 99.84 | |
| KOG4279 | 1226 | consensus Serine/threonine protein kinase [Signal | 99.84 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 99.84 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 99.84 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 99.84 | |
| cd06609 | 274 | STKc_MST3_like Catalytic domain of Mammalian Ste20 | 99.84 | |
| KOG1151 | 775 | consensus Tousled-like protein kinase [Signal tran | 99.84 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 99.84 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 99.84 | |
| cd05069 | 260 | PTKc_Yes Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd05073 | 260 | PTKc_Hck Catalytic domain of the Protein Tyrosine | 99.84 | |
| cd06612 | 256 | STKc_MST1_2 Catalytic domain of the Protein Serine | 99.84 | |
| cd05070 | 260 | PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros | 99.84 | |
| KOG0690 | 516 | consensus Serine/threonine protein kinase [Signal | 99.84 | |
| cd05047 | 270 | PTKc_Tie Catalytic domain of Tie Protein Tyrosine | 99.84 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 99.84 | |
| cd06627 | 254 | STKc_Cdc7_like Catalytic domain of Cell division c | 99.84 | |
| KOG0587 | 953 | consensus Traf2- and Nck-interacting kinase and re | 99.84 | |
| cd05118 | 283 | STKc_CMGC Catalytic domain of CMGC family Serine/T | 99.84 | |
| cd05581 | 280 | STKc_PDK1 Catalytic domain of the Protein Serine/T | 99.83 | |
| smart00219 | 258 | TyrKc Tyrosine kinase, catalytic domain. Phosphotr | 99.83 | |
| cd05056 | 270 | PTKc_FAK Catalytic domain of the Protein Tyrosine | 99.83 | |
| cd08530 | 256 | STKc_CNK2-like Catalytic domain of the Protein Ser | 99.83 | |
| PF07714 | 259 | Pkinase_Tyr: Protein tyrosine kinase Protein kinas | 99.83 | |
| cd05606 | 278 | STKc_beta_ARK Catalytic domain of the Protein Seri | 99.83 | |
| cd05083 | 254 | PTKc_Chk Catalytic domain of the Protein Tyrosine | 99.83 | |
| cd05060 | 257 | PTKc_Syk_like Catalytic domain of Spleen Tyrosine | 99.83 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 99.83 | |
| cd05085 | 250 | PTKc_Fer Catalytic domain of the Protein Tyrosine | 99.83 | |
| KOG0608 | 1034 | consensus Warts/lats-like serine threonine kinases | 99.83 | |
| cd05116 | 257 | PTKc_Syk Catalytic domain of the Protein Tyrosine | 99.83 | |
| cd06917 | 277 | STKc_NAK1_like Catalytic domain of Fungal Nak1-lik | 99.83 | |
| cd07838 | 287 | STKc_CDK4_6_like Catalytic domain of Cyclin-Depend | 99.83 | |
| cd05579 | 265 | STKc_MAST_like Catalytic domain of Microtubule-ass | 99.83 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.83 | |
| cd05074 | 273 | PTKc_Tyro3 Catalytic domain of the Protein Tyrosin | 99.83 | |
| cd05092 | 280 | PTKc_TrkA Catalytic domain of the Protein Tyrosine | 99.83 | |
| cd05040 | 257 | PTKc_Ack_like Catalytic domain of the Protein Tyro | 99.83 | |
| KOG0986 | 591 | consensus G protein-coupled receptor kinase [Signa | 99.83 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 99.83 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 99.83 | |
| cd06606 | 260 | STKc_MAPKKK Catalytic domain of the Protein Serine | 99.83 | |
| PRK10345 | 210 | hypothetical protein; Provisional | 99.83 | |
| cd05041 | 251 | PTKc_Fes_like Catalytic domain of Fes-like Protein | 99.82 | |
| cd05572 | 262 | STKc_cGK_PKG Catalytic domain of the Protein Serin | 99.82 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 99.82 | |
| cd06623 | 264 | PKc_MAPKK_plant_like Catalytic domain of Plant dua | 99.82 | |
| cd07829 | 282 | STKc_CDK_like Catalytic domain of Cyclin-Dependent | 99.82 | |
| cd06605 | 265 | PKc_MAPKK Catalytic domain of the dual-specificity | 99.82 | |
| cd05611 | 260 | STKc_Rim15_like Catalytic domain of fungal Rim15-l | 99.82 | |
| cd05145 | 190 | RIO1_like RIO kinase family; RIO1, RIO3 and simila | 99.82 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 99.82 | |
| cd08528 | 269 | STKc_Nek10 Catalytic domain of the Protein Serine/ | 99.82 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 99.82 | |
| cd05044 | 269 | PTKc_c-ros Catalytic domain of the Protein Tyrosin | 99.82 | |
| cd05058 | 262 | PTKc_Met_Ron Catalytic domain of the Protein Tyros | 99.82 | |
| KOG4645 | 1509 | consensus MAPKKK (MAP kinase kinase kinase) SSK2 a | 99.82 | |
| PHA03390 | 267 | pk1 serine/threonine-protein kinase 1; Provisional | 99.81 | |
| cd05122 | 253 | PKc_STE Catalytic domain of STE family Protein Kin | 99.81 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 99.81 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 99.81 | |
| cd05576 | 237 | STKc_RPK118_like Catalytic domain of the Protein S | 99.81 | |
| KOG0983 | 391 | consensus Mitogen-activated protein kinase (MAPK) | 99.81 | |
| cd08216 | 314 | PK_STRAD Pseudokinase domain of STE20-related kina | 99.81 | |
| KOG1165 | 449 | consensus Casein kinase (serine/threonine/tyrosine | 99.81 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 99.81 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 99.81 | |
| KOG0984 | 282 | consensus Mitogen-activated protein kinase (MAPK) | 99.81 | |
| cd05123 | 250 | STKc_AGC Catalytic domain of AGC family Protein Se | 99.81 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 99.8 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 99.8 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 99.8 | |
| KOG0669 | 376 | consensus Cyclin T-dependent kinase CDK9 [Cell cyc | 99.79 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 99.79 | |
| KOG0596 | 677 | consensus Dual specificity; serine/threonine and t | 99.78 | |
| KOG1164 | 322 | consensus Casein kinase (serine/threonine/tyrosine | 99.78 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 99.78 | |
| KOG0670 | 752 | consensus U4/U6-associated splicing factor PRP4 [R | 99.78 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 99.78 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 99.78 | |
| KOG0664 | 449 | consensus Nemo-like MAPK-related serine/threonine | 99.78 | |
| KOG0614 | 732 | consensus cGMP-dependent protein kinase [Signal tr | 99.78 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 99.77 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 99.77 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 99.76 | |
| smart00090 | 237 | RIO RIO-like kinase. | 99.76 | |
| KOG1167 | 418 | consensus Serine/threonine protein kinase of the C | 99.76 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 99.75 | |
| KOG0695 | 593 | consensus Serine/threonine protein kinase [Signal | 99.75 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 99.75 | |
| KOG1027 | 903 | consensus Serine/threonine protein kinase and endo | 99.75 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 99.73 | |
| KOG0696 | 683 | consensus Serine/threonine protein kinase [Signal | 99.73 | |
| smart00221 | 225 | STYKc Protein kinase; unclassified specificity. Ph | 99.73 | |
| cd00180 | 215 | PKc Catalytic domain of Protein Kinases. Protein K | 99.73 | |
| KOG1345 | 378 | consensus Serine/threonine kinase [Signal transduc | 99.72 | |
| PRK10359 | 232 | lipopolysaccharide core biosynthesis protein; Prov | 99.71 | |
| KOG0665 | 369 | consensus Jun-N-terminal kinase (JNK) [Signal tran | 99.69 | |
| PRK14879 | 211 | serine/threonine protein kinase; Provisional | 99.68 | |
| smart00220 | 244 | S_TKc Serine/Threonine protein kinases, catalytic | 99.66 | |
| TIGR03724 | 199 | arch_bud32 Kae1-associated kinase Bud32. Members o | 99.65 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 99.64 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 99.63 | |
| KOG0200 | 609 | consensus Fibroblast/platelet-derived growth facto | 99.63 | |
| PRK12274 | 218 | serine/threonine protein kinase; Provisional | 99.62 | |
| KOG1166 | 974 | consensus Mitotic checkpoint serine/threonine prot | 99.59 | |
| cd05119 | 187 | RIO RIO kinase family, catalytic domain. The RIO k | 99.58 | |
| COG0515 | 384 | SPS1 Serine/threonine protein kinase [General func | 99.56 | |
| KOG1024 | 563 | consensus Receptor-like protein tyrosine kinase RY | 99.49 | |
| cd05120 | 155 | APH_ChoK_like Aminoglycoside 3'-phosphotransferase | 99.49 | |
| PRK01723 | 239 | 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | 99.47 | |
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 99.22 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 99.21 | |
| KOG4158 | 598 | consensus BRPK/PTEN-induced protein kinase [Signal | 99.17 | |
| KOG0590 | 601 | consensus Checkpoint kinase and related serine/thr | 99.17 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 99.16 | |
| cd05151 | 170 | ChoK Choline Kinase (ChoK). The ChoK subfamily is | 99.16 | |
| cd05146 | 197 | RIO3_euk RIO kinase family; eukaryotic RIO3, catal | 99.14 | |
| PF14531 | 288 | Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_ | 99.11 | |
| KOG1240 | 1431 | consensus Protein kinase containing WD40 repeats [ | 99.01 | |
| KOG0603 | 612 | consensus Ribosomal protein S6 kinase [Signal tran | 98.8 | |
| cd05154 | 223 | ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an | 98.79 | |
| PRK15123 | 268 | lipopolysaccharide core heptose(I) kinase RfaP; Pr | 98.65 | |
| KOG0601 | 524 | consensus Cyclin-dependent kinase WEE1 [Cell cycle | 98.65 | |
| KOG3741 | 655 | consensus Poly(A) ribonuclease subunit [RNA proces | 98.64 | |
| KOG3087 | 229 | consensus Serine/threonine protein kinase [General | 98.64 | |
| PF01163 | 188 | RIO1: RIO1 family; InterPro: IPR018934 Protein pho | 98.5 | |
| KOG0601 | 524 | consensus Cyclin-dependent kinase WEE1 [Cell cycle | 98.5 | |
| COG3642 | 204 | Mn2+-dependent serine/threonine protein kinase [Si | 98.48 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 98.42 | |
| KOG1243 | 690 | consensus Protein kinase [General function predict | 98.33 | |
| KOG0590 | 601 | consensus Checkpoint kinase and related serine/thr | 98.32 | |
| COG0478 | 304 | RIO-like serine/threonine protein kinase fused to | 98.27 | |
| PF06293 | 206 | Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; | 98.23 | |
| KOG0195 | 448 | consensus Integrin-linked kinase [Signal transduct | 98.2 | |
| PRK09902 | 216 | hypothetical protein; Provisional | 98.07 | |
| KOG1266 | 458 | consensus Protein kinase [Signal transduction mech | 97.95 | |
| KOG1023 | 484 | consensus Natriuretic peptide receptor, guanylate | 97.91 | |
| PF06176 | 229 | WaaY: Lipopolysaccharide core biosynthesis protein | 97.9 | |
| COG0661 | 517 | AarF Predicted unusual protein kinase [General fun | 97.89 | |
| PF10707 | 199 | YrbL-PhoP_reg: PhoP regulatory network protein Yrb | 97.83 | |
| COG1718 | 268 | RIO1 Serine/threonine protein kinase involved in c | 97.83 | |
| PF13095 | 207 | FTA2: Kinetochore Sim4 complex subunit FTA2 | 97.76 | |
| KOG1235 | 538 | consensus Predicted unusual protein kinase [Genera | 97.68 | |
| KOG1033 | 516 | consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati | 97.43 | |
| KOG2270 | 520 | consensus Serine/threonine protein kinase involved | 97.4 | |
| TIGR02172 | 226 | Fb_sc_TIGR02172 Fibrobacter succinogenes paralogou | 97.2 | |
| COG2112 | 201 | Predicted Ser/Thr protein kinase [Signal transduct | 97.0 | |
| PF01636 | 239 | APH: Phosphotransferase enzyme family This family | 96.91 | |
| PLN02876 | 822 | acyl-CoA dehydrogenase | 96.9 | |
| cd05150 | 244 | APH Aminoglycoside 3'-phosphotransferase (APH). Th | 96.84 | |
| PRK10593 | 297 | hypothetical protein; Provisional | 96.45 | |
| KOG0576 | 829 | consensus Mitogen-activated protein kinase kinase | 96.4 | |
| KOG0606 | 1205 | consensus Microtubule-associated serine/threonine | 96.17 | |
| cd05157 | 235 | ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes. | 96.13 | |
| cd05155 | 235 | APH_ChoK_like_1 Uncharacterized bacterial proteins | 96.01 | |
| PF12260 | 188 | PIP49_C: Protein-kinase domain of FAM69; InterPro: | 95.93 | |
| TIGR02721 | 256 | ycfN_thiK thiamine kinase. Members of this family | 95.45 | |
| KOG1236 | 565 | consensus Predicted unusual protein kinase [Genera | 94.75 | |
| KOG1033 | 516 | consensus eIF-2alpha kinase PEK/EIF2AK3 [Translati | 94.61 | |
| PRK05231 | 319 | homoserine kinase; Provisional | 94.26 | |
| cd05153 | 296 | HomoserineK_II Homoserine Kinase, type II. Homoser | 94.12 | |
| PRK09550 | 401 | mtnK methylthioribose kinase; Reviewed | 94.09 | |
| TIGR00938 | 307 | thrB_alt homoserine kinase, Neisseria type. Homose | 94.09 | |
| TIGR02906 | 313 | spore_CotS spore coat protein, CotS family. Member | 93.82 | |
| KOG2268 | 465 | consensus Serine/threonine protein kinase [Signal | 93.74 | |
| PHA03111 | 444 | Ser/Thr kinase; Provisional | 92.95 | |
| cd05156 | 302 | ChoK_euk Choline Kinase (ChoK) in eukaryotes. The | 92.22 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 92.19 | |
| PLN02236 | 344 | choline kinase | 91.59 | |
| cd05152 | 276 | MPH2' Macrolide 2'-Phosphotransferase (MPH2'). MPH | 91.39 | |
| PF05445 | 434 | Pox_ser-thr_kin: Poxvirus serine/threonine protein | 90.64 | |
| TIGR02904 | 309 | spore_ysxE spore coat protein YsxE. Members of thi | 90.01 | |
| COG4248 | 637 | Uncharacterized protein with protein kinase and he | 89.94 | |
| PLN02756 | 418 | S-methyl-5-thioribose kinase | 88.46 | |
| PLN02421 | 330 | phosphotransferase, alcohol group as acceptor/kina | 87.72 | |
| PF03881 | 288 | Fructosamin_kin: Fructosamine kinase; InterPro: IP | 87.69 | |
| TIGR01767 | 370 | MTRK 5-methylthioribose kinase. This enzyme is inv | 85.89 | |
| PRK12396 | 409 | 5-methylribose kinase; Reviewed | 84.33 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 80.33 |
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
Probab=99.98 E-value=9.3e-33 Score=236.34 Aligned_cols=149 Identities=66% Similarity=1.021 Sum_probs=135.9
Q ss_pred eeccCCCCCCCCcccCeeeeEEeccCCceEEEEEEECCCCCEEEEEEeeccchhHHHHHHHHHHcCCCCeeecceeeeec
Q 024091 123 ATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRLLNHPNVVSLKHCFFST 202 (272)
Q Consensus 123 ~~~~~~~~~~~~~~~~y~~~~~lG~G~fg~V~~~~~~~~~~~vAvK~i~~~~~~~~~E~~~l~~l~h~nIv~l~~~~~~~ 202 (272)
.....+..........|...+++|.|+||.||+|....+++.||||.+.+++++..+|+++|+.++|||||+|..+|+..
T Consensus 10 ~~~~~~~~~~~~~~i~~~~~~liG~GsFg~Vyq~~~~e~~~~vAIKKv~~d~r~knrEl~im~~l~HpNIV~L~~~f~~~ 89 (364)
T KOG0658|consen 10 QTVAEGRNDGKKVEISYEAVRLIGSGSFGVVYQAKLRETEEEVAIKKVLQDKRYKNRELQIMRKLDHPNIVRLLYFFSSS 89 (364)
T ss_pred EEEeecCCCCcceEEEEEeeEEEeecccceEEEEEEcCCCceeEEEEecCCCCcCcHHHHHHHhcCCcCeeeEEEEEEec
Confidence 33444444555667789999999999999999999999999999999999999999999999999999999999998887
Q ss_pred ccCCceEEEEEeecccccHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCCceecCCCCCCeeC
Q 024091 203 TEKDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272 (272)
Q Consensus 203 ~~~~~~~~~lv~e~~~~~l~~~~~~~~~~~~~~~~~~~~~i~~qi~~~L~ylH~~~~iiHrDlKp~NILl 272 (272)
.+.+..|+.+||||++.++++.++++...+..++...++.|++||++||.|||. .+||||||||.|||+
T Consensus 90 ~~~d~~~lnlVleymP~tL~~~~r~~~~~~~~mp~~~iKLYt~Qlfrgl~yLh~-~~IcHRDIKPqNlLv 158 (364)
T KOG0658|consen 90 TESDEVYLNLVLEYMPETLYRVIRHYTRANQRMPLLEIKLYTYQLFRGLAYLHS-HGICHRDIKPQNLLV 158 (364)
T ss_pred CCCchhHHHHHHHhchHHHHHHHHHHhhcCCCCceeeeHHHHHHHHHHHHHHHh-cCcccCCCChheEEE
Confidence 766678999999999999999999988889999999999999999999999998 999999999999996
|
|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0611 consensus Predicted serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0588 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 | Back alignment and domain information |
|---|
| >KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 | Back alignment and domain information |
|---|
| >cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >KOG0662 consensus Cyclin-dependent kinase CDK5 [Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0586 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4717 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03207 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 | Back alignment and domain information |
|---|
| >cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0589 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 | Back alignment and domain information |
|---|
| >cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase | Back alignment and domain information |
|---|
| >cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase | Back alignment and domain information |
|---|
| >cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 | Back alignment and domain information |
|---|
| >KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13184 pknD serine/threonine-protein kinase; Reviewed | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase | Back alignment and domain information |
|---|
| >cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 | Back alignment and domain information |
|---|
| >KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription] | Back alignment and domain information |
|---|
| >cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 | Back alignment and domain information |
|---|
| >cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >PLN00009 cyclin-dependent kinase A; Provisional | Back alignment and domain information |
|---|
| >cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes | Back alignment and domain information |
|---|
| >cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants | Back alignment and domain information |
|---|
| >cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 | Back alignment and domain information |
|---|
| >KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 | Back alignment and domain information |
|---|
| >cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
| >cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 | Back alignment and domain information |
|---|
| >cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase | Back alignment and domain information |
|---|
| >cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 | Back alignment and domain information |
|---|
| >cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >KOG0612 consensus Rho-associated, coiled-coil containing protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 | Back alignment and domain information |
|---|
| >cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase | Back alignment and domain information |
|---|
| >cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 | Back alignment and domain information |
|---|
| >cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 | Back alignment and domain information |
|---|
| >cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta | Back alignment and domain information |
|---|
| >cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase | Back alignment and domain information |
|---|
| >cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors | Back alignment and domain information |
|---|
| >cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 | Back alignment and domain information |
|---|
| >cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl | Back alignment and domain information |
|---|
| >cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 | Back alignment and domain information |
|---|
| >cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 | Back alignment and domain information |
|---|
| >cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome | Back alignment and domain information |
|---|
| >cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 | Back alignment and domain information |
|---|
| >KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains | Back alignment and domain information |
|---|
| >cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 | Back alignment and domain information |
|---|
| >cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase | Back alignment and domain information |
|---|
| >cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 | Back alignment and domain information |
|---|
| >cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 | Back alignment and domain information |
|---|
| >cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 | Back alignment and domain information |
|---|
| >cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase | Back alignment and domain information |
|---|
| >cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 | Back alignment and domain information |
|---|
| >cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk | Back alignment and domain information |
|---|
| >cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases | Back alignment and domain information |
|---|
| >cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn | Back alignment and domain information |
|---|
| >cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B | Back alignment and domain information |
|---|
| >cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase | Back alignment and domain information |
|---|
| >cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 | Back alignment and domain information |
|---|
| >cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase | Back alignment and domain information |
|---|
| >cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain | Back alignment and domain information |
|---|
| >cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase | Back alignment and domain information |
|---|
| >cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src | Back alignment and domain information |
|---|
| >cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases | Back alignment and domain information |
|---|
| >cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 | Back alignment and domain information |
|---|
| >cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 | Back alignment and domain information |
|---|
| >cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 | Back alignment and domain information |
|---|
| >cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 | Back alignment and domain information |
|---|
| >cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors | Back alignment and domain information |
|---|
| >cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >PHA03210 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 | Back alignment and domain information |
|---|
| >KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0584 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk | Back alignment and domain information |
|---|
| >cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 | Back alignment and domain information |
|---|
| >cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 | Back alignment and domain information |
|---|
| >cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase | Back alignment and domain information |
|---|
| >cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 | Back alignment and domain information |
|---|
| >KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription] | Back alignment and domain information |
|---|
| >cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa | Back alignment and domain information |
|---|
| >cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C | Back alignment and domain information |
|---|
| >cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases | Back alignment and domain information |
|---|
| >cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase | Back alignment and domain information |
|---|
| >cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11 | Back alignment and domain information |
|---|
| >cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase) | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase | Back alignment and domain information |
|---|
| >cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes | Back alignment and domain information |
|---|
| >cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase | Back alignment and domain information |
|---|
| >cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 | Back alignment and domain information |
|---|
| >cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk | Back alignment and domain information |
|---|
| >KOG0690 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 | Back alignment and domain information |
|---|
| >smart00219 TyrKc Tyrosine kinase, catalytic domain | Back alignment and domain information |
|---|
| >cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase | Back alignment and domain information |
|---|
| >cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains | Back alignment and domain information |
|---|
| >PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase | Back alignment and domain information |
|---|
| >cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase | Back alignment and domain information |
|---|
| >cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer | Back alignment and domain information |
|---|
| >KOG0608 consensus Warts/lats-like serine threonine kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase | Back alignment and domain information |
|---|
| >cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3 | Back alignment and domain information |
|---|
| >cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A | Back alignment and domain information |
|---|
| >cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase | Back alignment and domain information |
|---|
| >KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase | Back alignment and domain information |
|---|
| >PRK10345 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins | Back alignment and domain information |
|---|
| >cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase | Back alignment and domain information |
|---|
| >cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros | Back alignment and domain information |
|---|
| >cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron | Back alignment and domain information |
|---|
| >KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA03390 pk1 serine/threonine-protein kinase 1; Provisional | Back alignment and domain information |
|---|
| >cd05122 PKc_STE Catalytic domain of STE family Protein Kinases | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins | Back alignment and domain information |
|---|
| >KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein | Back alignment and domain information |
|---|
| >KOG1165 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >KOG0596 consensus Dual specificity; serine/threonine and tyrosine kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0670 consensus U4/U6-associated splicing factor PRP4 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0695 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0696 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00221 STYKc Protein kinase; unclassified specificity | Back alignment and domain information |
|---|
| >cd00180 PKc Catalytic domain of Protein Kinases | Back alignment and domain information |
|---|
| >KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10359 lipopolysaccharide core biosynthesis protein; Provisional | Back alignment and domain information |
|---|
| >KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14879 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain | Back alignment and domain information |
|---|
| >TIGR03724 arch_bud32 Kae1-associated kinase Bud32 | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK12274 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05119 RIO RIO kinase family, catalytic domain | Back alignment and domain information |
|---|
| >COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG1024 consensus Receptor-like protein tyrosine kinase RYK/derailed [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family | Back alignment and domain information |
|---|
| >PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd05151 ChoK Choline Kinase (ChoK) | Back alignment and domain information |
|---|
| >cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain | Back alignment and domain information |
|---|
| >PF14531 Kinase-like: Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A | Back alignment and domain information |
|---|
| >KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins | Back alignment and domain information |
|---|
| >PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional | Back alignment and domain information |
|---|
| >KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >KOG3741 consensus Poly(A) ribonuclease subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3087 consensus Serine/threonine protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01163 RIO1: RIO1 family; InterPro: IPR018934 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG0601 consensus Cyclin-dependent kinase WEE1 [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3642 Mn2+-dependent serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >KOG1243 consensus Protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >COG0478 RIO-like serine/threonine protein kinase fused to N-terminal HTH domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06293 Kdo: Lipopolysaccharide kinase (Kdo/WaaP) family; InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >KOG0195 consensus Integrin-linked kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK09902 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1266 consensus Protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1023 consensus Natriuretic peptide receptor, guanylate cyclase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF06176 WaaY: Lipopolysaccharide core biosynthesis protein (WaaY); InterPro: IPR009330 This family consists of several bacterial lipopolysaccharide core biosynthesis proteins (WaaY or RfaY) | Back alignment and domain information |
|---|
| >COG0661 AarF Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PF10707 YrbL-PhoP_reg: PhoP regulatory network protein YrbL; InterPro: IPR019647 This entry represents proteins that are activated by the protein PhoP | Back alignment and domain information |
|---|
| >COG1718 RIO1 Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PF13095 FTA2: Kinetochore Sim4 complex subunit FTA2 | Back alignment and domain information |
|---|
| >KOG1235 consensus Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG2270 consensus Serine/threonine protein kinase involved in cell cycle control [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >TIGR02172 Fb_sc_TIGR02172 Fibrobacter succinogenes paralogous family TIGR02172 | Back alignment and domain information |
|---|
| >COG2112 Predicted Ser/Thr protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01636 APH: Phosphotransferase enzyme family This family is part of the larger protein kinase superfamily | Back alignment and domain information |
|---|
| >PLN02876 acyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >cd05150 APH Aminoglycoside 3'-phosphotransferase (APH) | Back alignment and domain information |
|---|
| >PRK10593 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0606 consensus Microtubule-associated serine/threonine kinase and related proteins [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >cd05157 ETNK_euk Ethanolamine kinase (ETNK) in eukaryotes | Back alignment and domain information |
|---|
| >cd05155 APH_ChoK_like_1 Uncharacterized bacterial proteins with similarity to Aminoglycoside 3'-phosphotransferase (APH) and Choline kinase (ChoK) family members | Back alignment and domain information |
|---|
| >PF12260 PIP49_C: Protein-kinase domain of FAM69; InterPro: IPR022049 Family with sequence similarity 69 has three members (A, B and C) | Back alignment and domain information |
|---|
| >TIGR02721 ycfN_thiK thiamine kinase | Back alignment and domain information |
|---|
| >KOG1236 consensus Predicted unusual protein kinase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1033 consensus eIF-2alpha kinase PEK/EIF2AK3 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK05231 homoserine kinase; Provisional | Back alignment and domain information |
|---|
| >cd05153 HomoserineK_II Homoserine Kinase, type II | Back alignment and domain information |
|---|
| >PRK09550 mtnK methylthioribose kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00938 thrB_alt homoserine kinase, Neisseria type | Back alignment and domain information |
|---|
| >TIGR02906 spore_CotS spore coat protein, CotS family | Back alignment and domain information |
|---|
| >KOG2268 consensus Serine/threonine protein kinase [Signal transduction mechanisms; General function prediction only] | Back alignment and domain information |
|---|
| >PHA03111 Ser/Thr kinase; Provisional | Back alignment and domain information |
|---|
| >cd05156 ChoK_euk Choline Kinase (ChoK) in eukaryotes | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >PLN02236 choline kinase | Back alignment and domain information |
|---|
| >cd05152 MPH2' Macrolide 2'-Phosphotransferase (MPH2') | Back alignment and domain information |
|---|
| >PF05445 Pox_ser-thr_kin: Poxvirus serine/threonine protein kinase; InterPro: IPR008790 This family of proteins contain poxvirus serine/threonine protein kinases, which are essential for phosphorylation of virion proteins during virion assembly | Back alignment and domain information |
|---|
| >TIGR02904 spore_ysxE spore coat protein YsxE | Back alignment and domain information |
|---|
| >COG4248 Uncharacterized protein with protein kinase and helix-hairpin-helix DNA-binding domains [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02756 S-methyl-5-thioribose kinase | Back alignment and domain information |
|---|
| >PLN02421 phosphotransferase, alcohol group as acceptor/kinase | Back alignment and domain information |
|---|
| >PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] | Back alignment and domain information |
|---|
| >TIGR01767 MTRK 5-methylthioribose kinase | Back alignment and domain information |
|---|
| >PRK12396 5-methylribose kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 272 | ||||
| 1q3d_A | 424 | Gsk-3 Beta Complexed With Staurosporine Length = 42 | 1e-50 | ||
| 3say_A | 430 | Crystal Structure Of Human Glycogen Synthase Kinase | 5e-50 | ||
| 1i09_A | 420 | Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Len | 5e-50 | ||
| 1pyx_A | 422 | Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | 6e-50 | ||
| 4acc_A | 465 | Gsk3b In Complex With Inhibitor Length = 465 | 7e-50 | ||
| 1q5k_A | 414 | Crystal Structure Of Glycogen Synthase Kinase 3 In | 7e-50 | ||
| 4dit_A | 382 | Crystal Structure Of Gsk3beta In Complex With A Imi | 8e-50 | ||
| 3zrk_A | 371 | Identification Of 2-(4-Pyridyl)thienopyridinones As | 9e-50 | ||
| 4afj_A | 367 | 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selec | 9e-50 | ||
| 1gng_A | 378 | Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With | 9e-50 | ||
| 2o5k_A | 372 | Crystal Structure Of Gsk3beta In Complex With A Ben | 1e-49 | ||
| 3gb2_A | 353 | Gsk3beta Inhibitor Complex Length = 353 | 2e-49 | ||
| 1r0e_A | 391 | Glycogen Synthase Kinase-3 Beta In Complex With 3-I | 6e-49 | ||
| 2ow3_A | 352 | Glycogen Synthase Kinase-3 Beta In Complex With Bis | 1e-48 | ||
| 3sd0_A | 350 | Identification Of A Glycogen Synthase Kinase-3b Inh | 1e-48 | ||
| 3zdi_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 1e-48 | ||
| 3f7z_A | 350 | X-ray Co-crystal Structure Of Glycogen Synthase Kin | 1e-48 | ||
| 4e7w_A | 394 | Structure Of Gsk3 From Ustilago Maydis Length = 394 | 7e-48 | ||
| 3f88_A | 349 | Glycogen Synthase Kinase 3beta Inhibitor Complex Le | 1e-47 | ||
| 1uv5_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With 6-Br | 6e-47 | ||
| 1h8f_A | 352 | Glycogen Synthase Kinase 3 Beta. Length = 352 | 6e-47 | ||
| 1o9u_A | 350 | Glycogen Synthase Kinase 3 Beta Complexed With Axin | 3e-46 | ||
| 3e3p_A | 360 | Glycogen Synthase Kinase From Leishmania Major Leng | 8e-30 | ||
| 3eb0_A | 383 | Crystal Structure Of Cgd4_240 From Cryptosporidium | 2e-28 | ||
| 2wqm_A | 310 | Structure Of Apo Human Nek7 Length = 310 | 3e-14 | ||
| 4agu_A | 311 | Crystal Structure Of The Human Cdkl1 Kinase Domain | 1e-13 | ||
| 4erw_A | 306 | Cdk2 In Complex With Staurosporine Length = 306 | 2e-12 | ||
| 3pxf_A | 306 | Cdk2 In Complex With Two Molecules Of 8-Anilino-1-N | 2e-12 | ||
| 1oit_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 5e-12 | ||
| 1gz8_A | 299 | Human Cyclin Dependent Kinase 2 Complexed With The | 7e-12 | ||
| 1vyw_A | 309 | Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = | 7e-12 | ||
| 2iw8_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82 | 8e-12 | ||
| 3ezr_A | 300 | Cdk-2 With Indazole Inhibitor 17 Bound At Its Activ | 8e-12 | ||
| 1ogu_A | 302 | Structure Of Human Thr160-phospho Cdk2/cyclin A Com | 8e-12 | ||
| 2jgz_A | 289 | Crystal Structure Of Phospho-Cdk2 In Complex With C | 8e-12 | ||
| 4eoq_A | 301 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 8e-12 | ||
| 4bcq_A | 301 | Structure Of Cdk2 In Complex With Cyclin A And A 2- | 8e-12 | ||
| 4eos_A | 300 | Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Co | 8e-12 | ||
| 1h1p_A | 303 | Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMP | 8e-12 | ||
| 3pj8_A | 299 | Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D] | 8e-12 | ||
| 3bht_A | 300 | Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN | 9e-12 | ||
| 1w98_A | 298 | The Structural Basis Of Cdk2 Activation By Cyclin E | 9e-12 | ||
| 1pf8_A | 298 | Crystal Structure Of Human Cyclin-dependent Kinase | 9e-12 | ||
| 1e9h_A | 297 | Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex | 9e-12 | ||
| 4i3z_A | 296 | Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNES | 9e-12 | ||
| 3qhr_A | 298 | Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic | 9e-12 | ||
| 2w17_A | 299 | Cdk2 In Complex With The Imidazole Pyrimidine Amide | 9e-12 | ||
| 1fin_A | 298 | Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = | 9e-12 | ||
| 1jst_A | 298 | Phosphorylated Cyclin-Dependent Kinase-2 Bound To C | 9e-12 | ||
| 1qmz_A | 299 | Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Com | 9e-12 | ||
| 4eok_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 1e-11 | ||
| 4eoj_A | 302 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Huma | 1e-11 | ||
| 4eom_A | 301 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 1e-11 | ||
| 4ic7_A | 442 | Crystal Structure Of The Erk5 Kinase Domain In Comp | 1e-11 | ||
| 4b99_A | 398 | Crystal Structure Of Mapk7 (Erk5) With Inhibitor Le | 1e-11 | ||
| 4eon_A | 300 | Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Hum | 1e-11 | ||
| 2iw6_A | 302 | Structure Of Human Thr160-Phospho Cdk2-Cyclin A Com | 2e-11 | ||
| 4eop_A | 300 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 2e-11 | ||
| 4eoo_A | 299 | Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 | 2e-11 | ||
| 1gii_A | 298 | Human Cyclin Dependent Kinase 2 Complexed With The | 3e-11 | ||
| 1oir_A | 299 | Imidazopyridines: A Potent And Selective Class Of C | 4e-11 | ||
| 1h01_A | 298 | Cdk2 In Complex With A Disubstituted 2, 4-Bis Anili | 4e-11 | ||
| 4eoi_A | 299 | Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyc | 5e-11 | ||
| 3rzf_A | 677 | Crystal Structure Of Inhibitor Of Kappab Kinase Bet | 1e-10 | ||
| 3qa8_A | 676 | Crystal Structure Of Inhibitor Of Kappa B Kinase Be | 1e-10 | ||
| 1how_A | 373 | The X-Ray Crystal Structure Of Sky1p, An Sr Protein | 1e-10 | ||
| 1q8y_A | 373 | The Structure Of The Yeast Sr Protein Kinase, Sky1p | 2e-10 | ||
| 1cm8_A | 367 | Phosphorylated Map Kinase P38-Gamma Length = 367 | 2e-10 | ||
| 2i6l_A | 320 | Crystal Structure Of Human Mitogen Activated Protei | 2e-10 | ||
| 3uto_A | 573 | Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin- | 2e-10 | ||
| 1koa_A | 491 | Twitchin Kinase Fragment (C.Elegans), Autoregulated | 2e-10 | ||
| 1h4l_A | 292 | Structure And Regulation Of The Cdk5-P25(Nck5a) Com | 4e-10 | ||
| 1ung_A | 292 | Structural Mechanism For The Inhibition Of Cdk5-P25 | 4e-10 | ||
| 3orx_A | 316 | Pdk1 Mutant Bound To Allosteric Disulfide Fragment | 5e-10 | ||
| 3niz_A | 311 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 7e-10 | ||
| 2qkr_A | 313 | Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5 | 8e-10 | ||
| 3gc9_A | 370 | The Structure Of P38beta C119s, C162s In Complex Wi | 8e-10 | ||
| 3oz6_A | 388 | Crystal Structure Of Mapk From Cryptosporidium Parv | 9e-10 | ||
| 4a07_A | 311 | Human Pdk1 Kinase Domain In Complex With Allosteric | 1e-09 | ||
| 3hrc_A | 311 | Crystal Structure Of A Mutant Of Human Pdk1 Kinase | 1e-09 | ||
| 3gc8_A | 370 | The Structure Of P38beta C162s In Complex With A Di | 2e-09 | ||
| 2r7b_A | 312 | Crystal Structure Of The Phosphoinositide-Dependent | 2e-09 | ||
| 2biy_A | 310 | Structure Of Pdk1-S241a Mutant Kinase Domain Length | 2e-09 | ||
| 3iop_A | 312 | Pdk-1 In Complex With The Inhibitor Compound-8i Len | 2e-09 | ||
| 3g51_A | 325 | Structural Diversity Of The Active Conformation Of | 2e-09 | ||
| 3sc1_A | 311 | Novel Isoquinolone Pdk1 Inhibitors Discovered Throu | 2e-09 | ||
| 2gnj_A | 350 | Pka Three Fold Mutant Model Of Rho-Kinase With Y-27 | 2e-09 | ||
| 1ydt_E | 350 | Structure Of Camp-Dependent Protein Kinase, Alpha-C | 2e-09 | ||
| 3qc4_A | 314 | Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = | 2e-09 | ||
| 3rwp_A | 311 | Discovery Of A Novel, Potent And Selective Inhibito | 2e-09 | ||
| 3h9o_A | 311 | Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) | 2e-09 | ||
| 4el9_A | 305 | Structure Of N-Terminal Kinase Domain Of Rsk2 With | 2e-09 | ||
| 1uu3_A | 310 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 2e-09 | ||
| 2xch_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 2e-09 | ||
| 4exu_A | 371 | Mapk13, Inactive Form Length = 371 | 2e-09 | ||
| 3ubd_A | 304 | Structure Of N-Terminal Domain Of Rsk2 Kinase In Co | 2e-09 | ||
| 4aaa_A | 331 | Crystal Structure Of The Human Cdkl2 Kinase Domain | 2e-09 | ||
| 3hx4_A | 508 | Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg | 2e-09 | ||
| 3gp0_A | 348 | Crystal Structure Of Human Mitogen Activated Protei | 2e-09 | ||
| 3ku2_A | 507 | Crystal Structure Of Inactivated Form Of Cdpk1 From | 2e-09 | ||
| 1uu9_A | 286 | Structure Of Human Pdk1 Kinase Domain In Complex Wi | 3e-09 | ||
| 1z5m_A | 286 | Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrr | 3e-09 | ||
| 1q8w_A | 350 | The Catalytic Subunit Of Camp-Dependent Protein Kin | 3e-09 | ||
| 2jds_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 3e-09 | ||
| 1h1w_A | 289 | High Resolution Crystal Structure Of The Human Pdk1 | 3e-09 | ||
| 1xh7_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 3e-09 | ||
| 3nus_A | 286 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fra | 3e-09 | ||
| 2f7e_E | 351 | Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoqu | 3e-09 | ||
| 3d83_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 3e-09 | ||
| 2c1a_A | 351 | Structure Of Camp-Dependent Protein Kinase Complexe | 3e-09 | ||
| 3v8s_A | 410 | Human Rho-Associated Protein Kinase 1 (Rock 1) In C | 3e-09 | ||
| 2esm_A | 415 | Crystal Structure Of Rock 1 Bound To Fasudil Length | 3e-09 | ||
| 1svh_A | 350 | Crystal Structure Of Protein Kinase A In Complex Wi | 3e-09 | ||
| 3dnd_A | 350 | Camp-Dependent Protein Kinase Pka Catalytic Subunit | 3e-09 | ||
| 2v55_A | 406 | Mechanism Of Multi-site Phosphorylation From A Rock | 3e-09 | ||
| 3i79_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 3e-09 | ||
| 3gcp_A | 360 | Human P38 Map Kinase In Complex With Sb203580 Lengt | 3e-09 | ||
| 3nun_A | 292 | Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lea | 3e-09 | ||
| 3py3_A | 380 | Crystal Structure Of Phosphorylated P38alpha Map Ki | 3e-09 | ||
| 1stc_E | 350 | Camp-Dependent Protein Kinase, Alpha-Catalytic Subu | 3e-09 | ||
| 3tg1_A | 380 | Crystal Structure Of P38alpha In Complex With A Map | 3e-09 | ||
| 1bmk_A | 379 | The Complex Structure Of The Map Kinase P38SB218655 | 4e-09 | ||
| 3d7z_A | 360 | Crystal Structure Of P38 Kinase In Complex With A B | 4e-09 | ||
| 3pwy_A | 311 | Crystal Structure Of An Extender (Spd28345)-Modifie | 4e-09 | ||
| 2gnf_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 4e-09 | ||
| 3nax_A | 311 | Pdk1 In Complex With Inhibitor Mp7 Length = 311 | 4e-09 | ||
| 2gng_A | 350 | Protein Kinase A Fivefold Mutant Model Of Rho-Kinas | 4e-09 | ||
| 3nay_A | 311 | Pdk1 In Complex With Inhibitor Mp6 Length = 311 | 4e-09 | ||
| 1yw2_A | 360 | Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | 4e-09 | ||
| 3p4k_A | 370 | The Third Conformation Of P38a Map Kinase Observed | 4e-09 | ||
| 1ywr_A | 360 | Crystal Structure Analysis Of Inactive P38 Kinase D | 4e-09 | ||
| 1lew_A | 360 | Crystal Structure Of Map Kinase P38 Complexed To Th | 4e-09 | ||
| 2puu_A | 348 | Crystal Structure Of P38 Complex With 1-(5-Tert-But | 4e-09 | ||
| 1cdk_A | 350 | Camp-Dependent Protein Kinase Catalytic Subunit (E. | 4e-09 | ||
| 2gtm_A | 348 | Mutated Mouse P38 Map Kinase Domain In Complex With | 5e-09 | ||
| 1cmk_E | 350 | Crystal Structures Of The Myristylated Catalytic Su | 5e-09 | ||
| 2uzt_A | 336 | Pka Structures Of Akt, Indazole-Pyridine Inhibitors | 5e-09 | ||
| 2ghl_A | 348 | Mutant Mus Musculus P38 Kinase Domain In Complex Wi | 5e-09 | ||
| 1ctp_E | 350 | Structure Of The Mammalian Catalytic Subunit Of Cam | 5e-09 | ||
| 2oza_B | 366 | Structure Of P38alpha Complex Length = 366 | 5e-09 | ||
| 3gi3_A | 360 | Crystal Structure Of A N-Phenyl-N'-Naphthylurea Ana | 5e-09 | ||
| 2y8o_A | 362 | Crystal Structure Of Human P38alpha Complexed With | 5e-09 | ||
| 1ove_A | 366 | The Structure Of P38 Alpha In Complex With A Dihydr | 5e-09 | ||
| 3e92_A | 371 | Crystal Structure Of P38 Kinase In Complex With A B | 5e-09 | ||
| 3coi_A | 353 | Crystal Structure Of P38delta Kinase Length = 353 | 6e-09 | ||
| 1oz1_A | 372 | P38 Mitogen-Activated Kinase In Complex With 4-Azai | 6e-09 | ||
| 2gfs_A | 372 | P38 Kinase Crystal Structure In Complex With Ro3201 | 6e-09 | ||
| 3oht_A | 389 | Crystal Structure Of Salmo Salar P38alpha Length = | 6e-09 | ||
| 3fi4_A | 372 | P38 Kinase Crystal Structure In Complex With Ro4499 | 6e-09 | ||
| 2bal_A | 365 | P38alpha Map Kinase Bound To Pyrazoloamine Length = | 6e-09 | ||
| 1xh9_A | 350 | Crystal Structures Of Protein Kinase B Selective In | 6e-09 | ||
| 2fst_X | 367 | Mitogen Activated Protein Kinase P38alpha (d176a+f3 | 6e-09 | ||
| 3kq7_A | 380 | Structure Of Human P38alpha With N-[4-Methyl-3-(6-{ | 6e-09 | ||
| 1bl6_A | 379 | The Complex Structure Of The Map Kinase P38SB216995 | 6e-09 | ||
| 2fsl_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a+f3 | 6e-09 | ||
| 2xck_A | 309 | Crystal Structure Of Pdk1 In Complex With A Pyrazol | 6e-09 | ||
| 4ewq_A | 383 | Human P38 Alpha Mapk In Complex With A Pyridazine B | 6e-09 | ||
| 3mh0_A | 360 | Mutagenesis Of P38 Map Kinase Eshtablishes Key Role | 6e-09 | ||
| 1smh_A | 350 | Protein Kinase A Variant Complex With Completely Or | 6e-09 | ||
| 3odz_X | 360 | Crystal Structure Of P38alpha Y323r Active Mutant L | 6e-09 | ||
| 3k3j_A | 362 | P38alpha Bound To Novel Dfg-Out Compound Pf-0041612 | 6e-09 | ||
| 3dt1_A | 383 | P38 Complexed With A Quinazoline Inhibitor Length = | 7e-09 | ||
| 3mpt_A | 371 | Crystal Structure Of P38 Kinase In Complex With A P | 7e-09 | ||
| 2fso_X | 367 | Mitogen Activated Protein Kinase P38alpha (D176a) A | 7e-09 | ||
| 1m7q_A | 366 | Crystal Structure Of P38 Map Kinase In Complex With | 7e-09 | ||
| 2npq_A | 367 | A Novel Lipid Binding Site In The P38 Alpha Map Kin | 7e-09 | ||
| 3od6_X | 360 | Crystal Structure Of P38alpha Y323t Active Mutant L | 7e-09 | ||
| 3hvc_A | 362 | Crystal Structure Of Human P38alpha Map Kinase Leng | 7e-09 | ||
| 3mh1_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 7e-09 | ||
| 3mh3_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 7e-09 | ||
| 3ody_X | 360 | Crystal Structure Of P38alpha Y323q Active Mutant L | 7e-09 | ||
| 3oef_X | 360 | Crystal Structure Of Y323f Inactive Mutant Of P38al | 7e-09 | ||
| 3nnx_A | 354 | Crystal Structure Of Phosphorylated P38 Alpha In Co | 7e-09 | ||
| 4e5a_X | 360 | The W197a Mutant Of P38a Map Kinase Length = 360 | 7e-09 | ||
| 3k3i_A | 350 | P38alpha Bound To Novel Dgf-Out Compound Pf-0021595 | 7e-09 | ||
| 3o8p_A | 360 | Conformational Plasticity Of P38 Map Kinase Dfg Mot | 7e-09 | ||
| 1di9_A | 360 | The Structure Of P38 Mitogen-Activated Protein Kina | 8e-09 | ||
| 3gcu_A | 360 | Human P38 Map Kinase In Complex With Rl48 Length = | 8e-09 | ||
| 3s3i_A | 349 | P38 Kinase Crystal Structure In Complex With Small | 8e-09 | ||
| 3nnu_A | 354 | Crystal Structure Of P38 Alpha In Complex With Dp13 | 8e-09 | ||
| 2baj_A | 365 | P38alpha Bound To Pyrazolourea Length = 365 | 8e-09 | ||
| 3hrb_A | 359 | P38 Kinase Crystal Structure In Complex With Small | 8e-09 | ||
| 2baq_A | 365 | P38alpha Bound To Ro3201195 Length = 365 | 8e-09 | ||
| 2lgc_A | 359 | Joint Nmr And X-Ray Refinement Reveals The Structur | 8e-09 | ||
| 3mh2_A | 360 | Mutagenesis Of P38 Map Kinase Establishes Key Roles | 8e-09 | ||
| 3zsg_A | 362 | X-Ray Structure Of P38alpha Bound To Tak-715 Length | 8e-09 | ||
| 3hec_A | 348 | P38 In Complex With Imatinib Length = 348 | 8e-09 | ||
| 1zzl_A | 351 | Crystal Structure Of P38 With Triazolopyridine Leng | 9e-09 | ||
| 2f9g_A | 353 | Crystal Structure Of Fus3 Phosphorylated On Tyr182 | 9e-09 | ||
| 2z7q_A | 321 | Crystal Structure Of The N-Terminal Kinase Domain O | 9e-09 | ||
| 1ian_A | 366 | Human P38 Map Kinase Inhibitor Complex Length = 366 | 1e-08 | ||
| 2f57_A | 317 | Crystal Structure Of The Human P21-activated Kinase | 1e-08 | ||
| 3daj_A | 272 | Crystal Structure Of Aurora A Complexed With An Inh | 1e-08 | ||
| 2b9f_A | 353 | Crystal Structure Of Non-Phosphorylated Fus3 Length | 1e-08 | ||
| 2b9h_A | 353 | Crystal Structure Of Fus3 With A Docking Motif From | 1e-08 | ||
| 3ma6_A | 298 | Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr | 1e-08 | ||
| 3dtc_A | 271 | Crystal Structure Of Mixed-Lineage Kinase Mlk1 Comp | 1e-08 | ||
| 3mvj_A | 371 | Human Cyclic Amp-Dependent Protein Kinase Pka Inhib | 1e-08 | ||
| 2zoq_A | 382 | Structural Dissection Of Human Mitogen-Activated Ki | 1e-08 | ||
| 3nx8_A | 351 | Human Camp Dependent Protein Kinase In Complex With | 1e-08 | ||
| 3agm_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-08 | ||
| 3agl_A | 351 | Complex Of Pka With The Bisubstrate Protein Kinase | 1e-08 | ||
| 3i7c_A | 484 | Calcium-Dependent Protein Kinase 1 From Toxoplasma | 1e-08 | ||
| 3d14_A | 272 | Crystal Structure Of Mouse Aurora A (Asn186->gly, L | 1e-08 | ||
| 4ae9_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-08 | ||
| 2hak_A | 328 | Catalytic And Ubiqutin-Associated Domains Of Mark1P | 1e-08 | ||
| 1apm_E | 350 | 2.0 Angstrom Refined Crystal Structure Of The Catal | 1e-08 | ||
| 1szm_A | 350 | Dual Binding Mode Of Bisindolylmaleimide 2 To Prote | 1e-08 | ||
| 1bi8_A | 326 | Mechanism Of G1 Cyclin Dependent Kinase Inhibition | 1e-08 | ||
| 2bmc_A | 306 | Aurora-2 T287d T288d Complexed With Pha-680632 Leng | 1e-08 | ||
| 4ae6_A | 343 | Structure And Function Of The Human Sperm-specific | 1e-08 | ||
| 4dg3_E | 371 | Crystal Structure Of R336a Mutant Of Camp-dependent | 1e-08 | ||
| 3fhi_A | 350 | Crystal Structure Of A Complex Between The Catalyti | 2e-08 | ||
| 3ama_A | 351 | Protein Kinase A Sixfold Mutant Model Of Aurora B W | 2e-08 | ||
| 2j4z_A | 306 | Structure Of Aurora-2 In Complex With Pha-680626 Le | 2e-08 | ||
| 1q61_A | 350 | Pka Triple Mutant Model Of Pkb Length = 350 | 2e-08 | ||
| 2qcs_A | 350 | A Complex Structure Between The Catalytic And Regul | 2e-08 | ||
| 1q24_A | 350 | Pka Double Mutant Model Of Pkb In Complex With Mgat | 2e-08 | ||
| 1muo_A | 297 | Crystal Structure Of Aurora-2, An Oncogenic Serine- | 2e-08 | ||
| 1j3h_A | 350 | Crystal Structure Of Apoenzyme Camp-Dependent Prote | 2e-08 | ||
| 1jow_B | 308 | Crystal Structure Of A Complex Of Human Cdk6 And A | 2e-08 | ||
| 4dfy_A | 371 | Crystal Structure Of R194a Mutant Of Camp-Dependent | 2e-08 | ||
| 1l3r_E | 350 | Crystal Structure Of A Transition State Mimic Of Th | 2e-08 | ||
| 3nup_A | 307 | Cdk6 (Monomeric) In Complex With Inhibitor Length = | 2e-08 | ||
| 1rdq_E | 350 | Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of | 2e-08 | ||
| 3qbn_A | 281 | Structure Of Human Aurora A In Complex With A Diami | 2e-08 | ||
| 2qur_A | 350 | Crystal Structure Of F327aK285P MUTANT OF CAMP-Depe | 2e-08 | ||
| 3qal_E | 350 | Crystal Structure Of Arg280ala Mutant Of Catalytic | 2e-08 | ||
| 2erz_E | 351 | Crystal Structure Of C-amp Dependent Kinase (pka) B | 2e-08 | ||
| 1jbp_E | 350 | Crystal Structure Of The Catalytic Subunit Of Camp- | 2e-08 | ||
| 3qam_E | 350 | Crystal Structure Of Glu208ala Mutant Of Catalytic | 2e-08 | ||
| 1fmo_E | 350 | Crystal Structure Of A Polyhistidine-Tagged Recombi | 2e-08 | ||
| 3pvb_A | 345 | Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca | 2e-08 | ||
| 4dfx_E | 350 | Crystal Structure Of Myristoylated K7c Catalytic Su | 2e-08 | ||
| 2f2u_A | 402 | Crystal Structure Of The Rho-Kinase Kinase Domain L | 2e-08 | ||
| 1bkx_A | 350 | A Binary Complex Of The Catalytic Subunit Of Camp-D | 2e-08 | ||
| 1syk_A | 350 | Crystal Structure Of E230q Mutant Of Camp-Dependent | 2e-08 | ||
| 2x6d_A | 285 | Aurora-A Bound To An Inhibitor Length = 285 | 2e-08 | ||
| 2xng_A | 283 | Structure Of Aurora-A Bound To A Selective Imidazop | 2e-08 | ||
| 3nrm_A | 283 | Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibito | 2e-08 | ||
| 2dwb_A | 285 | Aurora-A Kinase Complexed With Amppnp Length = 285 | 2e-08 | ||
| 1ol5_A | 282 | Structure Of Aurora-A 122-403, Phosphorylated On Th | 3e-08 | ||
| 1ol6_A | 282 | Structure Of Unphosphorylated D274n Mutant Of Auror | 3e-08 | ||
| 2xru_A | 280 | Aurora-A T288e Complexed With Pha-828300 Length = 2 | 3e-08 | ||
| 3unz_A | 279 | Aurora A In Complex With Rpm1679 Length = 279 | 3e-08 | ||
| 3lau_A | 287 | Crystal Structure Of Aurora2 Kinase In Complex With | 3e-08 | ||
| 3fdn_A | 279 | Structure-Based Drug Design Of Novel Aurora Kinase | 3e-08 | ||
| 2gu8_A | 337 | Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel | 3e-08 | ||
| 2c6e_A | 283 | Aurora A Kinase Activated Mutant (T287d) In Complex | 3e-08 | ||
| 2j50_A | 280 | Structure Of Aurora-2 In Complex With Pha-739358 Le | 3e-08 | ||
| 2xne_A | 272 | Structure Of Aurora-A Bound To An Imidazopyrazine I | 3e-08 | ||
| 1mq4_A | 272 | Crystal Structure Of Aurora-A Protein Kinase Length | 3e-08 | ||
| 2w1d_A | 275 | Structure Determination Of Aurora Kinase In Complex | 3e-08 | ||
| 3h0y_A | 268 | Aurora A In Complex With A Bisanilinopyrimidine Len | 3e-08 | ||
| 2c6d_A | 275 | Aurora A Kinase Activated Mutant (T287d) In Complex | 3e-08 | ||
| 3r21_A | 271 | Design, Synthesis, And Biological Evaluation Of Pyr | 3e-08 | ||
| 3o50_A | 267 | Crystal Structure Of Benzamide 9 Bound To Auroraa L | 3e-08 | ||
| 2w1c_A | 275 | Structure Determination Of Aurora Kinase In Complex | 3e-08 | ||
| 1zmw_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 3e-08 | ||
| 2buj_A | 317 | Crystal Structure Of The Human Serine-Threonine Kin | 3e-08 | ||
| 3ha6_A | 268 | Crystal Structure Of Aurora A In Complex With Tpx2 | 3e-08 | ||
| 3coh_A | 268 | Crystal Structure Of Aurora-A In Complex With A Pen | 3e-08 | ||
| 3e5a_A | 268 | Crystal Structure Of Aurora A In Complex With Vx-68 | 3e-08 | ||
| 1zmu_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 3e-08 | ||
| 2r0i_A | 327 | Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len | 3e-08 | ||
| 2qnj_A | 328 | Kinase And Ubiquitin-Associated Domains Of Mark3PAR | 3e-08 | ||
| 3gbz_A | 329 | Structure Of The Cmgc Cdk Kinase From Giardia Lambl | 3e-08 | ||
| 3dae_A | 283 | Crystal Structure Of Phosphorylated Snf1 Kinase Dom | 3e-08 | ||
| 3hyh_A | 275 | Crystal Structure Of The Protein Kinase Domain Of Y | 4e-08 | ||
| 3o7l_B | 350 | Crystal Structure Of Phospholamban (1-19):pka C-Sub | 4e-08 | ||
| 2uvy_A | 351 | Structure Of Pka-pkb Chimera Complexed With Methyl- | 4e-08 | ||
| 3pg1_A | 362 | Map Kinase Lmampk10 From Leishmania Major (1.95 Ang | 4e-08 | ||
| 2x4f_A | 373 | The Crystal Structure Of The Human Myosin Light Cha | 4e-08 | ||
| 3mtl_A | 324 | Crystal Structure Of The Pctaire1 Kinase In Complex | 4e-08 | ||
| 3uib_A | 362 | Map Kinase Lmampk10 From Leishmania Major In Comple | 5e-08 | ||
| 3mn3_A | 271 | An Inhibited Conformation For The Protein Kinase Do | 5e-08 | ||
| 2fh9_A | 274 | Structure And Dimerization Of The Kinase Domain Fro | 5e-08 | ||
| 2ycr_A | 323 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 5e-08 | ||
| 2vo0_A | 351 | Structure Of Pka-Pkb Chimera Complexed With C-(4-(4 | 5e-08 | ||
| 2jdt_A | 351 | Structure Of Pka-Pkb Chimera Complexed With Isoquin | 5e-08 | ||
| 2ycf_A | 322 | Crystal Structure Of Checkpoint Kinase 2 In Complex | 5e-08 | ||
| 2cn5_A | 329 | Crystal Structure Of Human Chk2 In Complex With Adp | 5e-08 | ||
| 2w0j_A | 323 | Crystal Structure Of Chk2 In Complex With Nsc 10955 | 5e-08 | ||
| 2xk9_A | 322 | Structural Analysis Of Checkpoint Kinase 2 (Chk2) I | 6e-08 | ||
| 3fe3_A | 328 | Crystal Structure Of The Kinase Mark3PAR-1: T211a-S | 6e-08 | ||
| 3l9m_A | 351 | Crystal Structure Of Pkab3 (Pka Triple Mutant V123a | 6e-08 | ||
| 2wzj_A | 327 | Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 | 7e-08 | ||
| 2vwi_A | 303 | Structure Of The Osr1 Kinase, A Hypertension Drug T | 7e-08 | ||
| 1tki_A | 321 | Autoinhibited Serine Kinase Domain Of The Giant Mus | 7e-08 | ||
| 1zmv_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 7e-08 | ||
| 2w4o_A | 349 | Crystal Structure Of Human Camk4 In Complex With 4- | 7e-08 | ||
| 2wqe_A | 262 | Structure Of S155r Aurora-A Somatic Mutant Length = | 8e-08 | ||
| 3iec_A | 319 | Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K | 8e-08 | ||
| 3dak_A | 290 | Crystal Structure Of Domain-Swapped Osr1 Kinase Dom | 9e-08 | ||
| 3rgf_A | 405 | Crystal Structure Of Human Cdk8CYCC Length = 405 | 1e-07 | ||
| 4e4m_A | 302 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 3 | 1e-07 | ||
| 1kob_A | 387 | Twitchin Kinase Fragment (Aplysia), Autoregulated P | 1e-07 | ||
| 3tjc_A | 298 | Co-Crystal Structure Of Jak2 With Thienopyridine 8 | 1e-07 | ||
| 2w1i_A | 326 | Structure Determination Of Aurora Kinase In Complex | 1e-07 | ||
| 3p23_A | 432 | Crystal Structure Of The Human Kinase And Rnase Dom | 1e-07 | ||
| 4hge_A | 300 | Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 | 1e-07 | ||
| 2jam_A | 304 | Crystal Structure Of Human Calmodulin-Dependent Pro | 1e-07 | ||
| 3io7_A | 313 | 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Sel | 1e-07 | ||
| 3lpb_A | 295 | Crystal Structure Of Jak2 Complexed With A Potent 2 | 1e-07 | ||
| 2wtv_A | 285 | Aurora-A Inhibitor Structure Length = 285 | 1e-07 | ||
| 4aqc_A | 301 | Triazolopyridine-Based Inhibitor Of Janus Kinase 2 | 1e-07 | ||
| 3rvg_A | 303 | Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido | 2e-07 | ||
| 3q32_A | 301 | Structure Of Janus Kinase 2 With A Pyrrolotriazine | 2e-07 | ||
| 2b7a_A | 293 | The Structural Basis Of Janus Kinase 2 Inhibition B | 2e-07 | ||
| 1a06_A | 332 | Calmodulin-Dependent Protein Kinase From Rat Length | 2e-07 | ||
| 3e62_A | 293 | Fragment Based Discovery Of Jak-2 Inhibitors Length | 2e-07 | ||
| 2wtw_A | 285 | Aurora-A Inhibitor Structure (2nd Crystal Form) Len | 2e-07 | ||
| 4e6d_A | 298 | Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex W | 2e-07 | ||
| 3ugc_A | 295 | Structural Basis Of Jak2 Inhibition By The Type Ii | 2e-07 | ||
| 3jy9_A | 311 | Janus Kinase 2 Inhibitors Length = 311 | 2e-07 | ||
| 3ppz_A | 309 | Crystal Structure Of Ctr1 Kinase Domain In Complex | 2e-07 | ||
| 3i6u_A | 419 | Structure And Activation Mechanism Of The Chk2 Dna- | 2e-07 | ||
| 3i6w_A | 443 | Structure And Activation Mechanism Of The Chk2 Dna- | 2e-07 | ||
| 2dyl_A | 318 | Crystal Structure Of Human Mitogen-Activated Protei | 3e-07 | ||
| 1na7_A | 329 | Crystal Structure Of The Catalytic Subunit Of Human | 3e-07 | ||
| 3txo_A | 353 | Pkc Eta Kinase In Complex With A Naphthyridine Leng | 3e-07 | ||
| 4gsb_A | 364 | Monoclinic Crystal Form Of The Apo-Erk2 Length = 36 | 3e-07 | ||
| 1pme_A | 380 | Structure Of Penta Mutant Human Erk2 Map Kinase Com | 4e-07 | ||
| 1fot_A | 318 | Structure Of The Unliganded Camp-Dependent Protein | 4e-07 | ||
| 2w96_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 4e-07 | ||
| 1u5q_A | 348 | Crystal Structure Of The Tao2 Kinase Domain: Activa | 4e-07 | ||
| 4fie_A | 423 | Full-Length Human Pak4 Length = 423 | 4e-07 | ||
| 2w99_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 4e-07 | ||
| 4h3q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 4e-07 | ||
| 4fr4_A | 384 | Crystal Structure Of Human SerineTHREONINE-Protein | 4e-07 | ||
| 2w9f_B | 306 | Crystal Structure Of Cdk4 In Complex With A D-Type | 4e-07 | ||
| 3rp9_A | 458 | Crystal Structure Of The Apo Mapk From Toxoplasma G | 5e-07 | ||
| 4fg9_A | 320 | Crystal Structure Of Human Calcium/calmodulin-depen | 5e-07 | ||
| 3tei_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 6e-07 | ||
| 4fg8_A | 315 | Crystal Structure Of Human Calcium/calmodulin-depen | 6e-07 | ||
| 4fg7_A | 293 | Crystal Structure Of Human Calcium/calmodulin-depen | 6e-07 | ||
| 4apc_A | 350 | Crystal Structure Of Human Nima-Related Kinase 1 (N | 6e-07 | ||
| 2gcd_A | 309 | Tao2 Kinase Domain-Staurosporine Structure Length = | 6e-07 | ||
| 3sa0_A | 360 | Complex Of Erk2 With Norathyriol Length = 360 | 6e-07 | ||
| 2xa4_A | 298 | Inhibitors Of Jak2 Kinase Domain Length = 298 | 6e-07 | ||
| 2wel_A | 327 | Crystal Structure Of Su6656-Bound CalciumCALMODULIN | 6e-07 | ||
| 4fif_A | 346 | Catalytic Domain Of Human Pak4 With Rpkplvdp Peptid | 6e-07 | ||
| 4fv7_A | 360 | Crystal Structure Of The Erk2 Complexed With E94 Le | 6e-07 | ||
| 1wzy_A | 368 | Crystal Structure Of Human Erk2 Complexed With A Py | 7e-07 | ||
| 1tvo_A | 368 | The Structure Of Erk2 In Complex With A Small Molec | 7e-07 | ||
| 2ojg_A | 380 | Crystal Structure Of Erk2 In Complex With N,n-dimet | 7e-07 | ||
| 4fux_A | 360 | Crystal Structure Of The Erk2 Complexed With E75 Le | 7e-07 | ||
| 3qyw_A | 364 | Crystal Structure Of Erk2 In Complex With An Inhibi | 7e-07 | ||
| 2cdz_A | 303 | Crystal Structure Of The Human P21-Activated Kinase | 7e-07 | ||
| 2y9q_A | 362 | Crystal Structure Of Human Erk2 Complexed With A Ma | 7e-07 | ||
| 3zuv_A | 364 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-07 | ||
| 2erk_A | 365 | Phosphorylated Map Kinase Erk2 Length = 365 | 8e-07 | ||
| 3zu7_A | 365 | Crystal Structure Of A Designed Selected Ankyrin Re | 8e-07 | ||
| 3r63_A | 358 | Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | 8e-07 | ||
| 2z7l_A | 366 | Unphosphorylated Mitogen Activated Protein Kinase E | 8e-07 | ||
| 3c9w_A | 357 | Crystal Structure Of Erk-2 With Hypothemycin Covale | 8e-07 | ||
| 2fys_B | 364 | Crystal Structure Of Erk2 Complex With Kim Peptide | 8e-07 | ||
| 4fv6_A | 360 | Crystal Structure Of The Erk2 Complexed With E57 Le | 8e-07 | ||
| 3p86_A | 309 | Crystal Structure Of Ctr1 Kinase Domain Mutant D676 | 8e-07 | ||
| 3o71_A | 358 | Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length | 8e-07 | ||
| 2bva_A | 292 | Crystal Structure Of The Human P21-Activated Kinase | 8e-07 | ||
| 3com_A | 314 | Crystal Structure Of Mst1 Kinase Length = 314 | 9e-07 | ||
| 2q0n_A | 301 | Structure Of Human P21 Activating Kinase 4 (Pak4) I | 9e-07 | ||
| 2x4z_A | 296 | Crystal Structure Of The Human P21-Activated Kinase | 9e-07 | ||
| 4bbe_A | 298 | Aminoalkylpyrimidine Inhibitor Complexes With Jak2 | 9e-07 | ||
| 2r5t_A | 373 | Crystal Structure Of Inactive Serum And Glucocortic | 9e-07 | ||
| 2vn9_A | 301 | Crystal Structure Of Human Calcium Calmodulin Depen | 9e-07 | ||
| 1ua2_A | 346 | Crystal Structure Of Human Cdk7 Length = 346 | 9e-07 | ||
| 2jc6_A | 334 | Crystal Structure Of Human Calmodulin-Dependent Pro | 1e-06 | ||
| 3h4j_B | 336 | Crystal Structure Of Pombe Ampk Kdaid Fragment Leng | 1e-06 | ||
| 2pk9_A | 317 | Structure Of The Pho85-pho80 Cdk-cyclin Complex Of | 1e-06 | ||
| 3g33_A | 308 | Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | 1e-06 | ||
| 4gs6_A | 315 | Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxoz | 1e-06 | ||
| 2vrx_A | 285 | Structure Of Aurora B Kinase In Complex With Zm4474 | 1e-06 | ||
| 2bfx_B | 284 | Mechanism Of Aurora-B Activation By Incenp And Inhi | 1e-06 | ||
| 2gph_A | 364 | Docking Motif Interactions In The Map Kinase Erk2 L | 2e-06 | ||
| 2bfy_A | 284 | Complex Of Aurora-B With Incenp And Hesperidin. Len | 2e-06 | ||
| 2eva_A | 307 | Structural Basis For The Interaction Of Tak1 Kinase | 2e-06 | ||
| 1gol_A | 364 | Coordinates Of Rat Map Kinase Erk2 With An Arginine | 2e-06 | ||
| 3ll6_A | 337 | Crystal Structure Of The Human Cyclin G Associated | 2e-06 | ||
| 2j7t_A | 302 | Crystal Structure Of Human Serine Threonine Kinase- | 2e-06 | ||
| 4bc6_A | 293 | Crystal Structure Of Human Serine Threonine Kinase- | 2e-06 | ||
| 1y8g_A | 327 | Catalytic And Ubiqutin-Associated Domains Of Mark2P | 2e-06 | ||
| 3a62_A | 327 | Crystal Structure Of Phosphorylated P70s6k1 Length | 2e-06 | ||
| 3a60_A | 327 | Crystal Structure Of Unphosphorylated P70s6k1 (Form | 3e-06 | ||
| 1vzo_A | 355 | The Structure Of The N-Terminal Kinase Domain Of Ms | 3e-06 | ||
| 3s95_A | 310 | Crystal Structure Of The Human Limk1 Kinase Domain | 3e-06 | ||
| 4g31_A | 299 | Crystal Structure Of Gsk6414 Bound To Perk (R587-R1 | 3e-06 | ||
| 3fi3_A | 364 | Crystal Structure Of Jnk3 With Indazole Inhibitor, | 3e-06 | ||
| 4h1j_A | 293 | Crystal Structure Of Pyk2 With The Pyrazole 13a Len | 3e-06 | ||
| 3cok_A | 278 | Crystal Structure Of Plk4 Kinase Length = 278 | 3e-06 | ||
| 3kvx_A | 364 | Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Le | 3e-06 | ||
| 4azf_A | 417 | Human Dyrk2 In Complex With Leucettine L41 Length = | 4e-06 | ||
| 3kvw_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 4e-06 | ||
| 3lxn_A | 318 | Structural And Thermodynamic Characterization Of Th | 4e-06 | ||
| 3zuu_A | 362 | The Structure Of Ost1 (D160a, S175d) Kinase In Comp | 4e-06 | ||
| 3cc6_A | 281 | Crystal Structure Of Kinase Domain Of Protein Tyros | 4e-06 | ||
| 3zut_A | 362 | The Structure Of Ost1 (D160a) Kinase Length = 362 | 4e-06 | ||
| 2r9s_A | 356 | C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Qu | 4e-06 | ||
| 3ujg_A | 361 | Crystal Structure Of Snrk2.6 In Complex With Hab1 L | 4e-06 | ||
| 3vn9_A | 340 | Rifined Crystal Structure Of Non-Phosphorylated Map | 5e-06 | ||
| 3f3z_A | 277 | Crystal Structure Of Cryptosporidium Parvum Calcium | 5e-06 | ||
| 3uc4_A | 362 | The Crystal Structure Of Snf1-Related Kinase 2.6 Le | 5e-06 | ||
| 2yza_A | 276 | Crystal Structure Of Kinase Domain Of Human 5'-Amp- | 5e-06 | ||
| 2h6d_A | 276 | Protein Kinase Domain Of The Human 5'-Amp-Activated | 5e-06 | ||
| 2qg5_A | 294 | Cryptosporidium Parvum Calcium Dependent Protein Ki | 5e-06 | ||
| 3fzo_A | 277 | Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosin | 5e-06 | ||
| 2a19_B | 284 | Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Leng | 6e-06 | ||
| 3fme_A | 290 | Crystal Structure Of Human Mitogen-Activated Protei | 7e-06 | ||
| 3fv8_A | 355 | Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Le | 7e-06 | ||
| 3e7o_A | 360 | Crystal Structure Of Jnk2 Length = 360 | 8e-06 | ||
| 4ec8_A | 373 | Structure Of Full Length Cdk9 In Complex With Cycli | 8e-06 | ||
| 3vum_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M7 | 8e-06 | ||
| 3nz0_A | 302 | Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 3 | 8e-06 | ||
| 3nyx_A | 302 | Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-T | 8e-06 | ||
| 3f69_A | 311 | Crystal Structure Of The Mycobacterium Tuberculosis | 8e-06 | ||
| 3n9x_A | 432 | Crystal Structure Of Map Kinase From Plasmodium Ber | 9e-06 | ||
| 3mi9_A | 351 | Crystal Structure Of Hiv-1 Tat Complexed With Human | 9e-06 | ||
| 4bcf_A | 331 | Structure Of Cdk9 In Complex With Cyclin T And A 2- | 9e-06 | ||
| 3ttj_A | 464 | Crystal Structure Of Jnk3 Complexed With Cc-359, A | 9e-06 | ||
| 4fsz_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 9e-06 | ||
| 1zrz_A | 364 | Crystal Structure Of The Catalytic Domain Of Atypic | 9e-06 | ||
| 3npc_A | 364 | Crystal Structure Of Jnk2 Complexed With Birb796 Le | 9e-06 | ||
| 3blh_A | 331 | Crystal Structure Of Human Cdk9CYCLINT1 Length = 33 | 9e-06 | ||
| 2vz6_A | 313 | Structure Of Human Calcium Calmodulin Dependent Pro | 9e-06 | ||
| 2ydj_A | 276 | Discovery Of Checkpoint Kinase Inhibitor Azd7762 By | 1e-05 | ||
| 3kn5_A | 325 | Crystal Structure Of The C-Terminal Kinase Domain O | 1e-05 | ||
| 2r0u_A | 323 | Crystal Structure Of Chek1 In Complex With Inhibito | 1e-05 | ||
| 2hog_A | 322 | Crystal Structure Of Chek1 In Complex With Inhibito | 1e-05 | ||
| 4fsy_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 1e-05 | ||
| 1pmn_A | 364 | Crystal Structure Of Jnk3 In Complex With An Imidaz | 1e-05 | ||
| 2ok1_A | 365 | Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3 | 1e-05 | ||
| 3ptg_A | 363 | Design And Synthesis Of A Novel, Orally Efficacious | 1e-05 | ||
| 2o0u_A | 364 | Crystal Structure Of Human Jnk3 Complexed With N-{3 | 1e-05 | ||
| 3sdj_A | 448 | Structure Of Rnase-Inactive Point Mutant Of Oligome | 1e-05 | ||
| 3f61_A | 311 | Crystal Structure Of M. Tuberculosis Pknb Leu33aspV | 1e-05 | ||
| 4dc2_A | 396 | Structure Of Pkc In Complex With A Substrate Peptid | 1e-05 | ||
| 3oxi_A | 362 | Design And Synthesis Of Disubstituted Thiophene And | 1e-05 | ||
| 1jnk_A | 423 | The C-Jun N-Terminal Kinase (Jnk3s) Complexed With | 1e-05 | ||
| 2exc_X | 356 | Inhibitor Complex Of Jnk3 Length = 356 | 1e-05 | ||
| 3k2l_A | 429 | Crystal Structure Of Dual-Specificity Tyrosine Phos | 1e-05 | ||
| 3fi2_A | 353 | Crystal Structure Of Jnk3 With Amino-Pyrazole Inhib | 1e-05 | ||
| 3fbv_A | 448 | Crystal Structure Of The Oligomer Formed By The Kin | 1e-05 | ||
| 3zh8_A | 349 | A Novel Small Molecule Apkc Inhibitor Length = 349 | 1e-05 | ||
| 4h36_A | 356 | Crystal Structure Of Jnk3 In Complex With Atf2 Pept | 1e-05 | ||
| 3ori_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain L33d | 1e-05 | ||
| 2vd5_A | 412 | Structure Of Human Myotonic Dystrophy Protein Kinas | 1e-05 | ||
| 2b1p_A | 355 | Inhibitor Complex Of Jnk3 Length = 355 | 1e-05 | ||
| 3mfr_A | 351 | Cask-4m Cam Kinase Domain, Native Length = 351 | 1e-05 | ||
| 2br1_A | 297 | Structure-Based Design Of Novel Chk1 Inhibitors: In | 1e-05 | ||
| 1ia8_A | 289 | The 1.7 A Crystal Structure Of Human Cell Cycle Che | 1e-05 | ||
| 1zlt_A | 295 | Crystal Structure Of Chk1 Complexed With A Hymenald | 1e-05 | ||
| 3vul_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 2e-05 | ||
| 3a8w_A | 345 | Crystal Structure Of Pkciota Kinase Domain Length = | 2e-05 | ||
| 4ft3_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 2e-05 | ||
| 2wtk_C | 305 | Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 | 2e-05 | ||
| 3vuk_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M5 | 2e-05 | ||
| 2rio_A | 434 | Structure Of The Dual Enzyme Ire1 Reveals The Basis | 2e-05 | ||
| 1mru_A | 311 | Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycob | 2e-05 | ||
| 3lj0_A | 434 | Ire1 Complexed With Adp And Quercetin Length = 434 | 2e-05 | ||
| 2y94_A | 476 | Structure Of An Active Form Of Mammalian Ampk Lengt | 2e-05 | ||
| 4fsw_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 2e-05 | ||
| 2pml_X | 348 | Crystal Structure Of Pfpk7 In Complex With An Atp A | 2e-05 | ||
| 3bhh_A | 295 | Crystal Structure Of Human Calcium/calmodulin-depen | 2e-05 | ||
| 4fsn_A | 278 | Crystal Structure Of The Chk1 Length = 278 | 2e-05 | ||
| 3q5i_A | 504 | Crystal Structure Of Pbanka_031420 Length = 504 | 2e-05 | ||
| 4fsm_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 2e-05 | ||
| 3orm_A | 311 | Mycobacterium Tuberculosis Pknb Kinase Domain D76a | 2e-05 | ||
| 3ot3_A | 273 | X-Ray Crystal Structure Of Compound 22k Bound To Hu | 2e-05 | ||
| 4fst_A | 269 | Crystal Structure Of The Chk1 Length = 269 | 2e-05 | ||
| 2x8e_A | 276 | Discovery Of A Novel Class Of Triazolones As Checkp | 2e-05 | ||
| 3jvr_A | 271 | Characterization Of The Chk1 Allosteric Inhibitor B | 2e-05 | ||
| 2clq_A | 295 | Structure Of Mitogen-Activated Protein Kinase Kinas | 2e-05 | ||
| 3vui_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 3e-05 | ||
| 4e1z_A | 291 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 3e-05 | ||
| 3uiu_A | 306 | Crystal Structure Of Apo-Pkr Kinase Domain Length = | 3e-05 | ||
| 4e20_A | 290 | Structure Of Mouse Tyk-2 Complexed To A 3-Aminoinda | 3e-05 | ||
| 2ghg_A | 269 | H-Chk1 Complexed With A431994 Length = 269 | 3e-05 | ||
| 1o6y_A | 299 | Catalytic Domain Of Pknb Kinase From Mycobacterium | 3e-05 | ||
| 2e9v_A | 268 | Structure Of H-Chk1 Complexed With A859017 Length = | 3e-05 | ||
| 2ayp_A | 269 | Crystal Structure Of Chk1 With An Indol Inhibitor L | 3e-05 | ||
| 2qr7_A | 342 | 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of | 3e-05 | ||
| 2qr8_A | 342 | 2.0a X-ray Structure Of C-terminal Kinase Domain Of | 3e-05 | ||
| 1ob3_A | 288 | Structure Of P. Falciparum Pfpk5 Length = 288 | 3e-05 | ||
| 1v0b_A | 288 | Crystal Structure Of The T198a Mutant Of Pfpk5 Leng | 3e-05 | ||
| 1v0o_A | 288 | Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulpho | 3e-05 | ||
| 2j51_A | 325 | Crystal Structure Of Human Ste20-Like Kinase Bound | 4e-05 | ||
| 2jfm_A | 325 | Crystal Structure Of Human Ste20-Like Kinase (Unlig | 4e-05 | ||
| 2jfl_A | 325 | Crystal Structure Of Human Ste20-Like Kinase ( Diph | 4e-05 | ||
| 3vw6_A | 269 | Crystal Structure Of Human Apoptosis Signal-Regulat | 4e-05 | ||
| 3igo_A | 486 | Crystal Structure Of Cryptosporidium Parvum Cdpk1, | 4e-05 | ||
| 1wbp_A | 397 | Srpk1 Bound To 9mer Docking Motif Peptide Length = | 4e-05 | ||
| 3vuh_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M3 | 5e-05 | ||
| 1yhv_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Two Po | 5e-05 | ||
| 2xs0_A | 386 | Linear Binding Motifs For Jnk And For Calcineurin A | 5e-05 | ||
| 1f3m_C | 297 | Crystal Structure Of Human SerineTHREONINE KINASE P | 6e-05 | ||
| 3q52_A | 306 | Structure Of Phosphorylated Pak1 Kinase Domain Leng | 6e-05 | ||
| 3fxz_A | 297 | Crystal Structure Of Pak1 Kinase Domain With Ruthen | 6e-05 | ||
| 3vug_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M2 | 6e-05 | ||
| 1zys_A | 273 | Co-Crystal Structure Of Checkpoint Kinase Chk1 With | 6e-05 | ||
| 3is5_A | 285 | Crystal Structure Of Cdpk Kinase Domain From Toxopl | 6e-05 | ||
| 3beg_A | 381 | Crystal Structure Of Sr Protein Kinase 1 Complexed | 6e-05 | ||
| 3vud_A | 370 | Crystal Structure Of A Cysteine-deficient Mutant M1 | 7e-05 | ||
| 3v3v_A | 379 | Structural And Functional Analysis Of Quercetagetin | 7e-05 | ||
| 3udb_A | 317 | Crystal Structure Of Snrk2.6 Length = 317 | 7e-05 | ||
| 3uc3_A | 361 | The Crystal Structure Of Snf1-Related Kinase 2.3 Le | 7e-05 | ||
| 1yvj_A | 290 | Crystal Structure Of The Jak3 Kinase Domain In Comp | 8e-05 | ||
| 1ukh_A | 369 | Structural Basis For The Selective Inhibition Of Jn | 8e-05 | ||
| 2xrw_A | 371 | Linear Binding Motifs For Jnk And For Calcineurin A | 8e-05 | ||
| 2y4i_C | 395 | Ksr2-Mek1 Heterodimer Length = 395 | 8e-05 | ||
| 4fsu_A | 279 | Crystal Structure Of The Chk1 Length = 279 | 8e-05 | ||
| 2x7g_A | 389 | Structure Of Human Serine-Arginine-Rich Protein-Spe | 9e-05 | ||
| 4af3_A | 292 | Human Aurora B Kinase In Complex With Incenp And Vx | 9e-05 | ||
| 3elj_A | 369 | Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine | 9e-05 | ||
| 3o17_A | 370 | Crystal Structure Of Jnk1-Alpha1 Isoform Length = 3 | 9e-05 | ||
| 2g01_A | 370 | Pyrazoloquinolones As Novel, Selective Jnk1 Inhibit | 9e-05 | ||
| 3lij_A | 494 | Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) | 1e-04 | ||
| 3anq_A | 368 | Human Dyrk1aINHIBITOR COMPLEX Length = 368 | 1e-04 | ||
| 2vx3_A | 382 | Crystal Structure Of The Human Dual Specificity Tyr | 1e-04 | ||
| 4aze_A | 382 | Human Dyrk1a In Complex With Leucettine L41 Length | 1e-04 | ||
| 3pze_A | 358 | Jnk1 In Complex With Inhibitor Length = 358 | 1e-04 | ||
| 2wei_A | 287 | Crystal Structure Of The Kinase Domain Of Cryptospo | 1e-04 | ||
| 3dfa_A | 286 | Crystal Structure Of Kinase Domain Of Calcium-depen | 1e-04 | ||
| 4hvd_A | 314 | Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h | 1e-04 | ||
| 3lxk_A | 327 | Structural And Thermodynamic Characterization Of Th | 1e-04 | ||
| 4eqm_A | 294 | Structural Analysis Of Staphylococcus Aureus Serine | 1e-04 | ||
| 3pjc_A | 315 | Crystal Structure Of Jak3 Complexed With A Potent A | 1e-04 | ||
| 3soa_A | 444 | Full-Length Human Camkii Length = 444 | 1e-04 | ||
| 3eqc_A | 360 | X-Ray Structure Of The Human Mitogen-Activated Prot | 1e-04 | ||
| 2bdw_A | 362 | Crystal Structure Of The Auto-Inhibited Kinase Doma | 2e-04 | ||
| 3nie_A | 429 | Crystal Structure Of Pf11_0147 Length = 429 | 2e-04 | ||
| 3orn_A | 307 | Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In | 2e-04 | ||
| 2v7o_A | 336 | Crystal Structure Of Human Calcium-Calmodulin-Depen | 2e-04 | ||
| 1s9j_A | 341 | X-Ray Structure Of The Human Mitogen-Activated Prot | 2e-04 | ||
| 4an2_A | 301 | Crystal Structures Of Human Mek1 With Carboxamide-B | 2e-04 | ||
| 2p55_A | 333 | X-Ray Structure Of The Human Mitogen-Activated Prot | 2e-04 | ||
| 4euu_A | 319 | Structure Of Bx-795 Complexed With Human Tbk1 Kinas | 2e-04 | ||
| 3aln_A | 327 | Crystal Structure Of Human Non-Phosphorylated Mkk4 | 2e-04 | ||
| 1xjd_A | 345 | Crystal Structure Of Pkc-Theta Complexed With Staur | 2e-04 | ||
| 3juh_A | 335 | Crystal Structure Of A Mutant Of Human Protein Kina | 2e-04 | ||
| 3mbl_A | 328 | Crystal Structure Of The Human Mitogen-Activated Pr | 2e-04 | ||
| 3dv3_A | 322 | Mek1 With Pf-04622664 Bound Length = 322 | 2e-04 | ||
| 3hzt_A | 467 | Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 | 2e-04 | ||
| 3dxn_A | 287 | Crystal Structure Of The Calcium-dependent Kinase F | 2e-04 | ||
| 3enm_A | 316 | The Structure Of The Map2k Mek6 Reveals An Autoinhi | 2e-04 | ||
| 3bhy_A | 283 | Crystal Structure Of Human Death Associated Protein | 2e-04 | ||
| 2c30_A | 321 | Crystal Structure Of The Human P21-Activated Kinase | 2e-04 | ||
| 3rny_A | 346 | Crystal Structure Of Human Rsk1 C-Terminal Kinase D | 2e-04 | ||
| 2pzi_A | 681 | Crystal Structure Of Protein Kinase Pkng From Mycob | 3e-04 | ||
| 3sls_A | 304 | Crystal Structure Of Human Mek-1 Kinase In Complex | 3e-04 | ||
| 2wnt_A | 330 | Crystal Structure Of The Human Ribosomal Protein S6 | 3e-04 | ||
| 3q4z_A | 306 | Structure Of Unphosphorylated Pak1 Kinase Domain Le | 3e-04 | ||
| 3tac_A | 361 | Crystal Structure Of The Liprin-AlphaCASK COMPLEX L | 3e-04 | ||
| 2j90_A | 304 | Crystal Structure Of Human Zip Kinase In Complex Wi | 3e-04 | ||
| 1zyc_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 3e-04 | ||
| 1yrp_A | 278 | Catalytic Domain Of Human Zip Kinase Phosphorylated | 3e-04 | ||
| 3c0g_A | 351 | Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Len | 3e-04 | ||
| 1zy4_A | 303 | Crystal Structure Of Eif2alpha Protein Kinase Gcn2: | 3e-04 | ||
| 3o96_A | 446 | Crystal Structure Of Human Akt1 With An Allosteric | 3e-04 | ||
| 4ejn_A | 446 | Crystal Structure Of Autoinhibited Form Of Akt1 In | 4e-04 | ||
| 2zv2_A | 298 | Crystal Structure Of Human CalciumCALMODULIN-Depend | 4e-04 | ||
| 3hko_A | 345 | Crystal Structure Of A Cdpk Kinase Domain From Cryp | 4e-04 | ||
| 3fpq_A | 290 | Crystal Structure Of The Kinase Domain Of Wnk1 Leng | 4e-04 | ||
| 3krw_A | 688 | Human Grk2 In Complex With Gbetgamma Subunits And B | 4e-04 | ||
| 3cik_A | 689 | Human Grk2 In Complex With Gbetagamma Subunits Leng | 4e-04 | ||
| 4eut_A | 396 | Structure Of Bx-795 Complexed With Unphosphorylated | 4e-04 | ||
| 4e4l_A | 302 | Jak1 Kinase (Jh1 Domain) In Complex With Compound 3 | 4e-04 | ||
| 3cqu_A | 342 | Crystal Structure Of Akt-1 Complexed With Substrate | 4e-04 | ||
| 1omw_A | 689 | Crystal Structure Of The Complex Between G Protein- | 4e-04 | ||
| 3psc_A | 695 | Bovine Grk2 In Complex With Gbetagamma Subunits Len | 4e-04 | ||
| 3ocb_A | 341 | Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor | 4e-04 | ||
| 4gv1_A | 340 | Pkb Alpha In Complex With Azd5363 Length = 340 | 5e-04 | ||
| 2y0a_A | 326 | Structure Of Dapk1 Construct Residues 1-304 Length | 5e-04 | ||
| 2jed_A | 352 | The Crystal Structure Of The Kinase Domain Of The P | 5e-04 | ||
| 3eyg_A | 290 | Crystal Structures Of Jak1 And Jak2 Inhibitor Compl | 5e-04 | ||
| 2xzs_A | 312 | Death Associated Protein Kinase 1 Residues 1-312 Le | 6e-04 | ||
| 2xuu_A | 334 | Crystal Structure Of A Dap-Kinase 1 Mutant Length = | 6e-04 | ||
| 2w4k_A | 302 | X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | 6e-04 | ||
| 2x0g_A | 334 | X-ray Structure Of A Dap-kinase Calmodulin Complex | 6e-04 | ||
| 1s9i_A | 354 | X-Ray Structure Of The Human Mitogen-Activated Prot | 6e-04 | ||
| 1z57_A | 339 | Crystal Structure Of Human Clk1 In Complex With 10z | 7e-04 | ||
| 2ya9_A | 361 | Crystal Structure Of The Autoinhibited Form Of Mous | 7e-04 | ||
| 3gni_B | 389 | Structure Of Strad And Mo25 Length = 389 | 7e-04 | ||
| 3f5u_A | 295 | Crystal Structure Of The Death Associated Protein K | 7e-04 | ||
| 2wtk_B | 373 | Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo2 | 7e-04 | ||
| 1p4f_A | 293 | Death Associated Protein Kinase Catalytic Domain Wi | 7e-04 | ||
| 2yak_A | 285 | Structure Of Death-Associated Protein Kinase 1 (Dap | 7e-04 | ||
| 3ofm_A | 350 | Structure Of A Human Ck2alpha Prime, The Paralog Is | 7e-04 | ||
| 3dfc_B | 295 | Crystal Structure Of A Glycine-Rich Loop Mutant Of | 7e-04 | ||
| 2vag_A | 339 | Crystal Structure Of Di-Phosphorylated Human Clk1 I | 7e-04 | ||
| 1ig1_A | 294 | 1.8a X-Ray Structure Of Ternary Complex Of A Cataly | 7e-04 | ||
| 1wvw_A | 278 | Crystal Structures Of Kinase Domain Of Dap Kinase I | 8e-04 | ||
| 2w4j_A | 277 | X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | 8e-04 | ||
| 3e3b_X | 339 | Crystal Structure Of Catalytic Subunit Of Human Pro | 9e-04 |
| >pdb|1Q3D|A Chain A, Gsk-3 Beta Complexed With Staurosporine Length = 424 | Back alignment and structure |
|
| >pdb|3SAY|A Chain A, Crystal Structure Of Human Glycogen Synthase Kinase 3 Beta (Gsk3b) In Complex With Inhibitor 142 Length = 430 | Back alignment and structure |
| >pdb|1I09|A Chain A, Structure Of Glycogen Synthase Kinase-3 (Gsk3b) Length = 420 | Back alignment and structure |
| >pdb|1PYX|A Chain A, Gsk-3 Beta Complexed With Amp-Pnp Length = 422 | Back alignment and structure |
| >pdb|4ACC|A Chain A, Gsk3b In Complex With Inhibitor Length = 465 | Back alignment and structure |
| >pdb|1Q5K|A Chain A, Crystal Structure Of Glycogen Synthase Kinase 3 In Complexed With Inhibitor Length = 414 | Back alignment and structure |
| >pdb|4DIT|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Imidazopyridine Inhibitor Length = 382 | Back alignment and structure |
| >pdb|3ZRK|A Chain A, Identification Of 2-(4-Pyridyl)thienopyridinones As Gsk-3beta Inhibitors Length = 371 | Back alignment and structure |
| >pdb|4AFJ|A Chain A, 5-Aryl-4-Carboxamide-1,3-Oxazoles: Potent And Selective Gsk-3 Inhibitors Length = 367 | Back alignment and structure |
| >pdb|1GNG|A Chain A, Glycogen Synthase Kinase-3 Beta (Gsk3) Complex With Frattide Peptide Length = 378 | Back alignment and structure |
| >pdb|2O5K|A Chain A, Crystal Structure Of Gsk3beta In Complex With A Benzoimidazol Inhibitor Length = 372 | Back alignment and structure |
| >pdb|3GB2|A Chain A, Gsk3beta Inhibitor Complex Length = 353 | Back alignment and structure |
| >pdb|1R0E|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With 3-Indolyl-4- Arylmaleimide Inhibitor Length = 391 | Back alignment and structure |
| >pdb|2OW3|A Chain A, Glycogen Synthase Kinase-3 Beta In Complex With Bis- (Indole)maleimide Pyridinophane Inhibitor Length = 352 | Back alignment and structure |
| >pdb|3SD0|A Chain A, Identification Of A Glycogen Synthase Kinase-3b Inhibitor That Attenuates Hyperactivity In Clock Mutant Mice Length = 350 | Back alignment and structure |
| >pdb|3ZDI|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide And Inhibitor 7d Length = 350 | Back alignment and structure |
| >pdb|3F7Z|A Chain A, X-ray Co-crystal Structure Of Glycogen Synthase Kinase 3beta In Complex With An Inhibitor Length = 350 | Back alignment and structure |
| >pdb|4E7W|A Chain A, Structure Of Gsk3 From Ustilago Maydis Length = 394 | Back alignment and structure |
| >pdb|3F88|A Chain A, Glycogen Synthase Kinase 3beta Inhibitor Complex Length = 349 | Back alignment and structure |
| >pdb|1UV5|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With 6-Bromoindirubin-3'-Oxime Length = 350 | Back alignment and structure |
| >pdb|1H8F|A Chain A, Glycogen Synthase Kinase 3 Beta. Length = 352 | Back alignment and structure |
| >pdb|1O9U|A Chain A, Glycogen Synthase Kinase 3 Beta Complexed With Axin Peptide Length = 350 | Back alignment and structure |
| >pdb|3E3P|A Chain A, Glycogen Synthase Kinase From Leishmania Major Length = 360 | Back alignment and structure |
| >pdb|3EB0|A Chain A, Crystal Structure Of Cgd4_240 From Cryptosporidium Parvum In Complex With Indirubin E804 Length = 383 | Back alignment and structure |
| >pdb|2WQM|A Chain A, Structure Of Apo Human Nek7 Length = 310 | Back alignment and structure |
| >pdb|4AGU|A Chain A, Crystal Structure Of The Human Cdkl1 Kinase Domain Length = 311 | Back alignment and structure |
| >pdb|4ERW|A Chain A, Cdk2 In Complex With Staurosporine Length = 306 | Back alignment and structure |
| >pdb|3PXF|A Chain A, Cdk2 In Complex With Two Molecules Of 8-Anilino-1-Naphthalene Sulfonate Length = 306 | Back alignment and structure |
| >pdb|1OIT|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-dependent Kinase Inhibitors Identified Through Structure-based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1GZ8|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Inhibitor 2-Amino-6-(3'-Methyl-2'-Oxo)butoxypurine Length = 299 | Back alignment and structure |
| >pdb|1VYW|A Chain A, Structure Of Cdk2CYCLIN A WITH PNU-292137 Length = 309 | Back alignment and structure |
| >pdb|2IW8|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A F82h-L83v- H84d Mutant With An O6-Cyclohexylmethylguanine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3EZR|A Chain A, Cdk-2 With Indazole Inhibitor 17 Bound At Its Active Site Length = 300 | Back alignment and structure |
| >pdb|1OGU|A Chain A, Structure Of Human Thr160-phospho Cdk2/cyclin A Complexed With A 2-arylamino-4-cyclohexylmethyl-5-nitroso-6- aminopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|2JGZ|A Chain A, Crystal Structure Of Phospho-Cdk2 In Complex With Cyclin B Length = 289 | Back alignment and structure |
| >pdb|4EOQ|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4BCQ|A Chain A, Structure Of Cdk2 In Complex With Cyclin A And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|4EOS|A Chain A, Thr 160 Phosphorylated Cdk2 Wt - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|1H1P|A Chain A, Structure Of Human Thr160-Phospho Cdk2CYCLIN A COMPLEXED With The Inhibitor Nu2058 Length = 303 | Back alignment and structure |
| >pdb|3PJ8|A Chain A, Structure Of Cdk2 In Complex With A Pyrazolo[4,3-D]pyrimidine Bioisostere Of Roscovitine Length = 299 | Back alignment and structure |
| >pdb|3BHT|A Chain A, Structure Of Phosphorylated Thr160 Cdk2CYCLIN A IN COMPLEX WITH THE Inhibitor Meriolin 3 Length = 300 | Back alignment and structure |
| >pdb|1W98|A Chain A, The Structural Basis Of Cdk2 Activation By Cyclin E Length = 298 | Back alignment and structure |
| >pdb|1PF8|A Chain A, Crystal Structure Of Human Cyclin-dependent Kinase 2 Complexed With A Nucleoside Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1E9H|A Chain A, Thr 160 Phosphorylated Cdk2-Human Cyclin A3 Complex With The Inhibitor Indirubin-5-Sulphonate Bound Length = 297 | Back alignment and structure |
| >pdb|4I3Z|A Chain A, Structure Of Pcdk2CYCLINA BOUND TO ADP AND 2 MAGNESIUM IONS Length = 296 | Back alignment and structure |
| >pdb|3QHR|A Chain A, Structure Of A Pcdk2CYCLINA TRANSITION-State Mimic Length = 298 | Back alignment and structure |
| >pdb|2W17|A Chain A, Cdk2 In Complex With The Imidazole Pyrimidine Amide, Compound (S)-8b Length = 299 | Back alignment and structure |
| >pdb|1FIN|A Chain A, Cyclin A-Cyclin-Dependent Kinase 2 Complex Length = 298 | Back alignment and structure |
| >pdb|1JST|A Chain A, Phosphorylated Cyclin-Dependent Kinase-2 Bound To Cyclin A Length = 298 | Back alignment and structure |
| >pdb|1QMZ|A Chain A, Phosphorylated Cdk2-Cyclyin A-Substrate Peptide Complex Length = 299 | Back alignment and structure |
| >pdb|4EOK|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With The Inhibitor Nu6102 Length = 300 | Back alignment and structure |
| >pdb|4EOJ|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, K89d - Human Cyclin A3 Complex With Atp Length = 302 | Back alignment and structure |
| >pdb|4EOM|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With Atp Length = 301 | Back alignment and structure |
| >pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 Kinase Domain In Complex With An Mkk5 Binding Fragment Length = 442 | Back alignment and structure |
| >pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (Erk5) With Inhibitor Length = 398 | Back alignment and structure |
| >pdb|4EON|A Chain A, Thr 160 Phosphorylated Cdk2 H84s, Q85m, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|2IW6|A Chain A, Structure Of Human Thr160-Phospho Cdk2-Cyclin A Complexed With A Bisanilinopyrimidine Inhibitor Length = 302 | Back alignment and structure |
| >pdb|4EOP|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 300 | Back alignment and structure |
| >pdb|4EOO|A Chain A, Thr 160 Phosphorylated Cdk2 Q131e - Human Cyclin A3 Complex With Atp Length = 299 | Back alignment and structure |
| >pdb|1GII|A Chain A, Human Cyclin Dependent Kinase 2 Complexed With The Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|1OIR|A Chain A, Imidazopyridines: A Potent And Selective Class Of Cyclin-Dependent Kinase Inhibitors Identified Through Structure-Based Hybridisation Length = 299 | Back alignment and structure |
| >pdb|1H01|A Chain A, Cdk2 In Complex With A Disubstituted 2, 4-Bis Anilino Pyrimidine Cdk4 Inhibitor Length = 298 | Back alignment and structure |
| >pdb|4EOI|A Chain A, Thr 160 Phosphorylated Cdk2 K89d, Q131e - Human Cyclin A3 Complex With The Inhibitor Ro3306 Length = 299 | Back alignment and structure |
| >pdb|3RZF|A Chain A, Crystal Structure Of Inhibitor Of Kappab Kinase Beta (I4122) Length = 677 | Back alignment and structure |
| >pdb|3QA8|A Chain A, Crystal Structure Of Inhibitor Of Kappa B Kinase Beta Length = 676 | Back alignment and structure |
| >pdb|1HOW|A Chain A, The X-Ray Crystal Structure Of Sky1p, An Sr Protein Kinase In Yeast Length = 373 | Back alignment and structure |
| >pdb|1Q8Y|A Chain A, The Structure Of The Yeast Sr Protein Kinase, Sky1p, With Bound Adp Length = 373 | Back alignment and structure |
| >pdb|1CM8|A Chain A, Phosphorylated Map Kinase P38-Gamma Length = 367 | Back alignment and structure |
| >pdb|2I6L|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 6 (Mapk6) Length = 320 | Back alignment and structure |
| >pdb|3UTO|A Chain A, Twitchin Kinase Region From C.Elegans (Fn31-Nl-Kin-Crd-Ig26) Length = 573 | Back alignment and structure |
| >pdb|1KOA|A Chain A, Twitchin Kinase Fragment (C.Elegans), Autoregulated Protein Kinase And Immunoglobulin Domains Length = 491 | Back alignment and structure |
| >pdb|1H4L|A Chain A, Structure And Regulation Of The Cdk5-P25(Nck5a) Complex Length = 292 | Back alignment and structure |
| >pdb|1UNG|A Chain A, Structural Mechanism For The Inhibition Of Cdk5-P25 By Roscovitine, Aloisine And Indirubin. Length = 292 | Back alignment and structure |
| >pdb|3ORX|A Chain A, Pdk1 Mutant Bound To Allosteric Disulfide Fragment Inhibitor 1f8 Length = 316 | Back alignment and structure |
| >pdb|3NIZ|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Adp Bound Length = 311 | Back alignment and structure |
| >pdb|2QKR|A Chain A, Cryptosporidium Parvum Cyclin-Dependent Kinase Cgd5_2510 With Indirubin 3'-Monoxime Bound Length = 313 | Back alignment and structure |
| >pdb|3GC9|A Chain A, The Structure Of P38beta C119s, C162s In Complex With A Dihydroquinazolinone Inhibitor Length = 370 | Back alignment and structure |
| >pdb|3OZ6|A Chain A, Crystal Structure Of Mapk From Cryptosporidium Parvum, Cgd2_1960 Length = 388 | Back alignment and structure |
| >pdb|4A07|A Chain A, Human Pdk1 Kinase Domain In Complex With Allosteric Activator Ps171 Bound To The Pif-Pocket Length = 311 | Back alignment and structure |
| >pdb|3HRC|A Chain A, Crystal Structure Of A Mutant Of Human Pdk1 Kinase Domain In Complex With Atp Length = 311 | Back alignment and structure |
| >pdb|3GC8|A Chain A, The Structure Of P38beta C162s In Complex With A Dihydroquinazolinone Length = 370 | Back alignment and structure |
| >pdb|2R7B|A Chain A, Crystal Structure Of The Phosphoinositide-Dependent Kinase- 1 (Pdk-1)catalytic Domain Bound To A Dibenzonaphthyridine Inhibitor Length = 312 | Back alignment and structure |
| >pdb|2BIY|A Chain A, Structure Of Pdk1-S241a Mutant Kinase Domain Length = 310 | Back alignment and structure |
| >pdb|3IOP|A Chain A, Pdk-1 In Complex With The Inhibitor Compound-8i Length = 312 | Back alignment and structure |
| >pdb|3G51|A Chain A, Structural Diversity Of The Active Conformation Of The N- Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 Length = 325 | Back alignment and structure |
| >pdb|3SC1|A Chain A, Novel Isoquinolone Pdk1 Inhibitors Discovered Through Fragment-Based Lead Discovery Length = 311 | Back alignment and structure |
| >pdb|2GNJ|A Chain A, Pka Three Fold Mutant Model Of Rho-Kinase With Y-27632 Length = 350 | Back alignment and structure |
| >pdb|1YDT|E Chain E, Structure Of Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With H89 Protein Kinase Inhibitor N-[2- (4-Bromocinnamylamino)ethyl]-5-Isoquinoline Length = 350 | Back alignment and structure |
| >pdb|3QC4|A Chain A, Pdk1 In Complex With Dfg-Out Inhibitor Xxx Length = 314 | Back alignment and structure |
| >pdb|3RWP|A Chain A, Discovery Of A Novel, Potent And Selective Inhibitor Of 3- Phosphoinositide Dependent Kinase (Pdk1) Length = 311 | Back alignment and structure |
| >pdb|3H9O|A Chain A, Phosphoinositide-Dependent Protein Kinase 1 (Pdk-1) In Complex With Compound 9 Length = 311 | Back alignment and structure |
| >pdb|4EL9|A Chain A, Structure Of N-Terminal Kinase Domain Of Rsk2 With Afzelin Length = 305 | Back alignment and structure |
| >pdb|1UU3|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Ly333531 Length = 310 | Back alignment and structure |
| >pdb|2XCH|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|4EXU|A Chain A, Mapk13, Inactive Form Length = 371 | Back alignment and structure |
| >pdb|3UBD|A Chain A, Structure Of N-Terminal Domain Of Rsk2 Kinase In Complex With Flavonoid Glycoside Sl0101 Length = 304 | Back alignment and structure |
| >pdb|4AAA|A Chain A, Crystal Structure Of The Human Cdkl2 Kinase Domain Length = 331 | Back alignment and structure |
| >pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 | Back alignment and structure |
| >pdb|3GP0|A Chain A, Crystal Structure Of Human Mitogen Activated Protein Kinase 11 (p38 Beta) In Complex With Nilotinib Length = 348 | Back alignment and structure |
| >pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 | Back alignment and structure |
| >pdb|1UU9|A Chain A, Structure Of Human Pdk1 Kinase Domain In Complex With Bim-3 Length = 286 | Back alignment and structure |
| >pdb|1Z5M|A Chain A, Crystal Structure Of N1-[3-[[5-bromo-2-[[3-[(1-pyrrolidinylcarbonyl) Amino]phenyl]amino]-4-pyrimidinyl]amino]propyl]-2,2- Dimethylpropanediamide Complexed With Human Pdk1 Length = 286 | Back alignment and structure |
| >pdb|1Q8W|A Chain A, The Catalytic Subunit Of Camp-Dependent Protein Kinase In Complex With Rho-Kinase Inhibitor Fasudil (Ha-1077) Length = 350 | Back alignment and structure |
| >pdb|2JDS|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With A- 443654 Length = 351 | Back alignment and structure |
| >pdb|1H1W|A Chain A, High Resolution Crystal Structure Of The Human Pdk1 Catalytic Domain Length = 289 | Back alignment and structure |
| >pdb|1XH7|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|3NUS|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Fragment8 Length = 286 | Back alignment and structure |
| >pdb|2F7E|E Chain E, Pka Complexed With (S)-2-(1h-Indol-3-Yl)-1-(5-Isoquinolin-6- Yl-Pyridin-3-Yloxymethyl-Etylamine Length = 351 | Back alignment and structure |
| >pdb|3D83|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|2C1A|A Chain A, Structure Of Camp-Dependent Protein Kinase Complexed With Isoquinoline-5-Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl)amide Length = 351 | Back alignment and structure |
| >pdb|3V8S|A Chain A, Human Rho-Associated Protein Kinase 1 (Rock 1) In Complex With Indazole Derivative (Compound 18) Length = 410 | Back alignment and structure |
| >pdb|2ESM|A Chain A, Crystal Structure Of Rock 1 Bound To Fasudil Length = 415 | Back alignment and structure |
| >pdb|1SVH|A Chain A, Crystal Structure Of Protein Kinase A In Complex With Azepane Derivative 8 Length = 350 | Back alignment and structure |
| >pdb|3DND|A Chain A, Camp-Dependent Protein Kinase Pka Catalytic Subunit With Pki-5-24 Length = 350 | Back alignment and structure |
| >pdb|2V55|A Chain A, Mechanism Of Multi-site Phosphorylation From A Rock-i:rhoe Complex Structure Length = 406 | Back alignment and structure |
| >pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 | Back alignment and structure |
| >pdb|3GCP|A Chain A, Human P38 Map Kinase In Complex With Sb203580 Length = 360 | Back alignment and structure |
| >pdb|3NUN|A Chain A, Phosphoinositide-Dependent Kinase-1 (Pdk1) With Lead Compound Length = 292 | Back alignment and structure |
| >pdb|3PY3|A Chain A, Crystal Structure Of Phosphorylated P38alpha Map Kinase Length = 380 | Back alignment and structure |
| >pdb|1STC|E Chain E, Camp-Dependent Protein Kinase, Alpha-Catalytic Subunit In Complex With Staurosporine Length = 350 | Back alignment and structure |
| >pdb|3TG1|A Chain A, Crystal Structure Of P38alpha In Complex With A Mapk Docking Partner Length = 380 | Back alignment and structure |
| >pdb|1BMK|A Chain A, The Complex Structure Of The Map Kinase P38SB218655 Length = 379 | Back alignment and structure |
| >pdb|3D7Z|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biphenyl Amide Inhibitor Length = 360 | Back alignment and structure |
| >pdb|3PWY|A Chain A, Crystal Structure Of An Extender (Spd28345)-Modified Human Pdk1 Complex 2 Length = 311 | Back alignment and structure |
| >pdb|2GNF|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase With Y- 27632 Length = 350 | Back alignment and structure |
| >pdb|3NAX|A Chain A, Pdk1 In Complex With Inhibitor Mp7 Length = 311 | Back alignment and structure |
| >pdb|2GNG|A Chain A, Protein Kinase A Fivefold Mutant Model Of Rho-Kinase Length = 350 | Back alignment and structure |
| >pdb|3NAY|A Chain A, Pdk1 In Complex With Inhibitor Mp6 Length = 311 | Back alignment and structure |
| >pdb|1YW2|A Chain A, Mutated Mus Musculus P38 Kinase (Mp38) Length = 360 | Back alignment and structure |
| >pdb|3P4K|A Chain A, The Third Conformation Of P38a Map Kinase Observed In Phosphorylated P38a And In Solution Length = 370 | Back alignment and structure |
| >pdb|1YWR|A Chain A, Crystal Structure Analysis Of Inactive P38 Kinase Domain In Complex With A Monocyclic Pyrazolone Inhibitor Length = 360 | Back alignment and structure |
| >pdb|1LEW|A Chain A, Crystal Structure Of Map Kinase P38 Complexed To The Docking Site On Its Nuclear Substrate Mef2a Length = 360 | Back alignment and structure |
| >pdb|2PUU|A Chain A, Crystal Structure Of P38 Complex With 1-(5-Tert-Butyl-2-P- Tolyl-2h-Pyrazol-3-Yl)-3-[4-(6-Morpholin-4-Ylmethyl- Pyridin-3-Yl)naphthalen-1-Yl]urea Length = 348 | Back alignment and structure |
| >pdb|1CDK|A Chain A, Camp-Dependent Protein Kinase Catalytic Subunit (E.C.2.7.1.37) (Protein Kinase A) Complexed With Protein Kinase Inhibitor Peptide Fragment 5-24 (Pki(5-24) Isoelectric Variant Ca) And Mn2+ Adenylyl Imidodiphosphate (Mnamp-Pnp) At Ph 5.6 And 7c And 4c Length = 350 | Back alignment and structure |
| >pdb|2GTM|A Chain A, Mutated Mouse P38 Map Kinase Domain In Complex With Inhibitor Pg-892579 Length = 348 | Back alignment and structure |
| >pdb|1CMK|E Chain E, Crystal Structures Of The Myristylated Catalytic Subunit Of Camp- Dependent Protein Kinase Reveal Open And Closed Conformations Length = 350 | Back alignment and structure |
| >pdb|2UZT|A Chain A, Pka Structures Of Akt, Indazole-Pyridine Inhibitors Length = 336 | Back alignment and structure |
| >pdb|2GHL|A Chain A, Mutant Mus Musculus P38 Kinase Domain In Complex With Inhibitor Pg-874743 Length = 348 | Back alignment and structure |
| >pdb|1CTP|E Chain E, Structure Of The Mammalian Catalytic Subunit Of Camp-Dependent Protein Kinase And An Inhibitor Peptide Displays An Open Conformation Length = 350 | Back alignment and structure |
| >pdb|2OZA|B Chain B, Structure Of P38alpha Complex Length = 366 | Back alignment and structure |
| >pdb|3GI3|A Chain A, Crystal Structure Of A N-Phenyl-N'-Naphthylurea Analog In Complex With P38 Map Kinase Length = 360 | Back alignment and structure |
| >pdb|2Y8O|A Chain A, Crystal Structure Of Human P38alpha Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|1OVE|A Chain A, The Structure Of P38 Alpha In Complex With A Dihydroquinolinone Length = 366 | Back alignment and structure |
| >pdb|3E92|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Biaryl Amide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|3COI|A Chain A, Crystal Structure Of P38delta Kinase Length = 353 | Back alignment and structure |
| >pdb|1OZ1|A Chain A, P38 Mitogen-Activated Kinase In Complex With 4-Azaindole Inhibitor Length = 372 | Back alignment and structure |
| >pdb|2GFS|A Chain A, P38 Kinase Crystal Structure In Complex With Ro3201195 Length = 372 | Back alignment and structure |
| >pdb|3OHT|A Chain A, Crystal Structure Of Salmo Salar P38alpha Length = 389 | Back alignment and structure |
| >pdb|3FI4|A Chain A, P38 Kinase Crystal Structure In Complex With Ro4499 Length = 372 | Back alignment and structure |
| >pdb|2BAL|A Chain A, P38alpha Map Kinase Bound To Pyrazoloamine Length = 365 | Back alignment and structure |
| >pdb|1XH9|A Chain A, Crystal Structures Of Protein Kinase B Selective Inhibitors In Complex With Protein Kinase A And Mutants Length = 350 | Back alignment and structure |
| >pdb|2FST|X Chain X, Mitogen Activated Protein Kinase P38alpha (d176a+f327l) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|3KQ7|A Chain A, Structure Of Human P38alpha With N-[4-Methyl-3-(6-{[2-(1- Methylpyrrolidin-2-Yl)ethyl]amino}pyridine-3- Amido)phenyl]- 2-(Morpholin-4-Yl)pyridine-4-Carboxamide Length = 380 | Back alignment and structure |
| >pdb|1BL6|A Chain A, The Complex Structure Of The Map Kinase P38SB216995 Length = 379 | Back alignment and structure |
| >pdb|2FSL|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a+f327s) Activating Mutant Form-A Length = 367 | Back alignment and structure |
| >pdb|2XCK|A Chain A, Crystal Structure Of Pdk1 In Complex With A Pyrazoloquinazoline Inhibitor Length = 309 | Back alignment and structure |
| >pdb|4EWQ|A Chain A, Human P38 Alpha Mapk In Complex With A Pyridazine Based Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3MH0|A Chain A, Mutagenesis Of P38 Map Kinase Eshtablishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|1SMH|A Chain A, Protein Kinase A Variant Complex With Completely Ordered N- Terminal Helix Length = 350 | Back alignment and structure |
| >pdb|3ODZ|X Chain X, Crystal Structure Of P38alpha Y323r Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3K3J|A Chain A, P38alpha Bound To Novel Dfg-Out Compound Pf-00416121 Length = 362 | Back alignment and structure |
| >pdb|3DT1|A Chain A, P38 Complexed With A Quinazoline Inhibitor Length = 383 | Back alignment and structure |
| >pdb|3MPT|A Chain A, Crystal Structure Of P38 Kinase In Complex With A Pyrrole-2- Carboxamide Inhibitor Length = 371 | Back alignment and structure |
| >pdb|2FSO|X Chain X, Mitogen Activated Protein Kinase P38alpha (D176a) Activating Mutant Length = 367 | Back alignment and structure |
| >pdb|1M7Q|A Chain A, Crystal Structure Of P38 Map Kinase In Complex With A Dihydroquinazolinone Inhibitor Length = 366 | Back alignment and structure |
| >pdb|2NPQ|A Chain A, A Novel Lipid Binding Site In The P38 Alpha Map Kinase Length = 367 | Back alignment and structure |
| >pdb|3OD6|X Chain X, Crystal Structure Of P38alpha Y323t Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3HVC|A Chain A, Crystal Structure Of Human P38alpha Map Kinase Length = 362 | Back alignment and structure |
| >pdb|3MH1|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3MH3|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3ODY|X Chain X, Crystal Structure Of P38alpha Y323q Active Mutant Length = 360 | Back alignment and structure |
| >pdb|3OEF|X Chain X, Crystal Structure Of Y323f Inactive Mutant Of P38alpha Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3NNX|A Chain A, Crystal Structure Of Phosphorylated P38 Alpha In Complex With Dp802 Length = 354 | Back alignment and structure |
| >pdb|4E5A|X Chain X, The W197a Mutant Of P38a Map Kinase Length = 360 | Back alignment and structure |
| >pdb|3K3I|A Chain A, P38alpha Bound To Novel Dgf-Out Compound Pf-00215955 Length = 350 | Back alignment and structure |
| >pdb|3O8P|A Chain A, Conformational Plasticity Of P38 Map Kinase Dfg Motif Mutants In Response To Inhibitor Binding Length = 360 | Back alignment and structure |
| >pdb|1DI9|A Chain A, The Structure Of P38 Mitogen-Activated Protein Kinase In Complex With 4-[3-Methylsulfanylanilino]-6,7- Dimethoxyquinazoline Length = 360 | Back alignment and structure |
| >pdb|3GCU|A Chain A, Human P38 Map Kinase In Complex With Rl48 Length = 360 | Back alignment and structure |
| >pdb|3S3I|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 349 | Back alignment and structure |
| >pdb|3NNU|A Chain A, Crystal Structure Of P38 Alpha In Complex With Dp1376 Length = 354 | Back alignment and structure |
| >pdb|2BAJ|A Chain A, P38alpha Bound To Pyrazolourea Length = 365 | Back alignment and structure |
| >pdb|3HRB|A Chain A, P38 Kinase Crystal Structure In Complex With Small Molecule Inhibitor Length = 359 | Back alignment and structure |
| >pdb|2BAQ|A Chain A, P38alpha Bound To Ro3201195 Length = 365 | Back alignment and structure |
| >pdb|2LGC|A Chain A, Joint Nmr And X-Ray Refinement Reveals The Structure Of A Novel Dibenzo[a,D]cycloheptenone InhibitorP38 MAP KINASE COMPLEX IN Solution Length = 359 | Back alignment and structure |
| >pdb|3MH2|A Chain A, Mutagenesis Of P38 Map Kinase Establishes Key Roles Of Phe169 In Function And Structural Dynamics And Reveals A Novel Dfg-Out State Length = 360 | Back alignment and structure |
| >pdb|3ZSG|A Chain A, X-Ray Structure Of P38alpha Bound To Tak-715 Length = 362 | Back alignment and structure |
| >pdb|3HEC|A Chain A, P38 In Complex With Imatinib Length = 348 | Back alignment and structure |
| >pdb|1ZZL|A Chain A, Crystal Structure Of P38 With Triazolopyridine Length = 351 | Back alignment and structure |
| >pdb|2F9G|A Chain A, Crystal Structure Of Fus3 Phosphorylated On Tyr182 Length = 353 | Back alignment and structure |
| >pdb|2Z7Q|A Chain A, Crystal Structure Of The N-Terminal Kinase Domain Of Human Rsk-1 Bound To Amp-Pcp Length = 321 | Back alignment and structure |
| >pdb|1IAN|A Chain A, Human P38 Map Kinase Inhibitor Complex Length = 366 | Back alignment and structure |
| >pdb|2F57|A Chain A, Crystal Structure Of The Human P21-activated Kinase 5 Length = 317 | Back alignment and structure |
| >pdb|3DAJ|A Chain A, Crystal Structure Of Aurora A Complexed With An Inhibitor Discovered Through Site-Directed Dynamic Tethering Length = 272 | Back alignment and structure |
| >pdb|2B9F|A Chain A, Crystal Structure Of Non-Phosphorylated Fus3 Length = 353 | Back alignment and structure |
| >pdb|2B9H|A Chain A, Crystal Structure Of Fus3 With A Docking Motif From Ste7 Length = 353 | Back alignment and structure |
| >pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 | Back alignment and structure |
| >pdb|3DTC|A Chain A, Crystal Structure Of Mixed-Lineage Kinase Mlk1 Complexed With Compound 16 Length = 271 | Back alignment and structure |
| >pdb|3MVJ|A Chain A, Human Cyclic Amp-Dependent Protein Kinase Pka Inhibitor Complex Length = 371 | Back alignment and structure |
| >pdb|2ZOQ|A Chain A, Structural Dissection Of Human Mitogen-Activated Kinase Erk1 Length = 382 | Back alignment and structure |
| >pdb|3NX8|A Chain A, Human Camp Dependent Protein Kinase In Complex With Phenol Length = 351 | Back alignment and structure |
| >pdb|3AGM|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-670 Length = 351 | Back alignment and structure |
| >pdb|3AGL|A Chain A, Complex Of Pka With The Bisubstrate Protein Kinase Inhibitor Arc-1039 Length = 351 | Back alignment and structure |
| >pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 | Back alignment and structure |
| >pdb|3D14|A Chain A, Crystal Structure Of Mouse Aurora A (Asn186->gly, Lys240->arg, Met302- >leu) In Complex With 1-{5-[2-(Thieno[3,2-D]pyrimidin-4-Ylamino)- Ethyl]- Thiazol-2-Yl}-3-(3-Trifluoromethyl-Phenyl)-Urea Length = 272 | Back alignment and structure |
| >pdb|4AE9|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit C Alpha 2 Length = 343 | Back alignment and structure |
| >pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 | Back alignment and structure |
| >pdb|1APM|E Chain E, 2.0 Angstrom Refined Crystal Structure Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With A Peptide Inhibitor And Detergent Length = 350 | Back alignment and structure |
| >pdb|1SZM|A Chain A, Dual Binding Mode Of Bisindolylmaleimide 2 To Protein Kinase A (Pka) Length = 350 | Back alignment and structure |
| >pdb|1BI8|A Chain A, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 326 | Back alignment and structure |
| >pdb|2BMC|A Chain A, Aurora-2 T287d T288d Complexed With Pha-680632 Length = 306 | Back alignment and structure |
| >pdb|4AE6|A Chain A, Structure And Function Of The Human Sperm-specific Isoform Of Protein Kinase A (pka) Catalytic Subunit Calpha 2 Length = 343 | Back alignment and structure |
| >pdb|4DG3|E Chain E, Crystal Structure Of R336a Mutant Of Camp-dependent Protein Kinase With Unphosphorylated Turn Motif Length = 371 | Back alignment and structure |
| >pdb|3FHI|A Chain A, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 350 | Back alignment and structure |
| >pdb|3AMA|A Chain A, Protein Kinase A Sixfold Mutant Model Of Aurora B With Inhibitor Jnj- 7706621 Length = 351 | Back alignment and structure |
| >pdb|2J4Z|A Chain A, Structure Of Aurora-2 In Complex With Pha-680626 Length = 306 | Back alignment and structure |
| >pdb|1Q61|A Chain A, Pka Triple Mutant Model Of Pkb Length = 350 | Back alignment and structure |
| >pdb|2QCS|A Chain A, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 350 | Back alignment and structure |
| >pdb|1Q24|A Chain A, Pka Double Mutant Model Of Pkb In Complex With Mgatp Length = 350 | Back alignment and structure |
| >pdb|1MUO|A Chain A, Crystal Structure Of Aurora-2, An Oncogenic Serine- Threonine Kinase Length = 297 | Back alignment and structure |
| >pdb|1J3H|A Chain A, Crystal Structure Of Apoenzyme Camp-Dependent Protein Kinase Catalytic Subunit Length = 350 | Back alignment and structure |
| >pdb|1JOW|B Chain B, Crystal Structure Of A Complex Of Human Cdk6 And A Viral Cyclin Length = 308 | Back alignment and structure |
| >pdb|4DFY|A Chain A, Crystal Structure Of R194a Mutant Of Camp-Dependent Protein Kinase With Unphosphorylated Activation Loop Length = 371 | Back alignment and structure |
| >pdb|1L3R|E Chain E, Crystal Structure Of A Transition State Mimic Of The Catalytic Subunit Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3NUP|A Chain A, Cdk6 (Monomeric) In Complex With Inhibitor Length = 307 | Back alignment and structure |
| >pdb|1RDQ|E Chain E, Hydrolysis Of Atp In The Crystal Of Y204a Mutant Of Camp-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3QBN|A Chain A, Structure Of Human Aurora A In Complex With A Diaminopyrimidine Length = 281 | Back alignment and structure |
| >pdb|2QUR|A Chain A, Crystal Structure Of F327aK285P MUTANT OF CAMP-Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|3QAL|E Chain E, Crystal Structure Of Arg280ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|2ERZ|E Chain E, Crystal Structure Of C-amp Dependent Kinase (pka) Bound To Hydroxyfasudil Length = 351 | Back alignment and structure |
| >pdb|1JBP|E Chain E, Crystal Structure Of The Catalytic Subunit Of Camp- Dependent Protein Kinase Complexed With A Substrate Peptide, Adp And Detergent Length = 350 | Back alignment and structure |
| >pdb|3QAM|E Chain E, Crystal Structure Of Glu208ala Mutant Of Catalytic Subunit Of Camp- Dependent Protein Kinase Length = 350 | Back alignment and structure |
| >pdb|1FMO|E Chain E, Crystal Structure Of A Polyhistidine-Tagged Recombinant Catalytic Subunit Of Camp-Dependent Protein Kinase Complexed With The Peptide Inhibitor Pki(5-24) And Adenosine Length = 350 | Back alignment and structure |
| >pdb|3PVB|A Chain A, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 345 | Back alignment and structure |
| >pdb|4DFX|E Chain E, Crystal Structure Of Myristoylated K7c Catalytic Subunit Of Camp- Dependent Protein Kinase In Complex With Sp20 And Amp-Pnp Length = 350 | Back alignment and structure |
| >pdb|2F2U|A Chain A, Crystal Structure Of The Rho-Kinase Kinase Domain Length = 402 | Back alignment and structure |
| >pdb|1BKX|A Chain A, A Binary Complex Of The Catalytic Subunit Of Camp-Dependent Protein Kinase And Adenosine Further Defines Conformational Flexibility Length = 350 | Back alignment and structure |
| >pdb|1SYK|A Chain A, Crystal Structure Of E230q Mutant Of Camp-Dependent Protein Kinase Reveals Unexpected Apoenzyme Conformation Length = 350 | Back alignment and structure |
| >pdb|2X6D|A Chain A, Aurora-A Bound To An Inhibitor Length = 285 | Back alignment and structure |
| >pdb|2XNG|A Chain A, Structure Of Aurora-A Bound To A Selective Imidazopyrazine Inhibitor Length = 283 | Back alignment and structure |
| >pdb|3NRM|A Chain A, Imidazo[1,2-A]pyrazine-Based Aurora Kinase Inhibitors Length = 283 | Back alignment and structure |
| >pdb|2DWB|A Chain A, Aurora-A Kinase Complexed With Amppnp Length = 285 | Back alignment and structure |
| >pdb|1OL5|A Chain A, Structure Of Aurora-A 122-403, Phosphorylated On Thr287, Thr288 And Bound To Tpx2 1-43 Length = 282 | Back alignment and structure |
| >pdb|1OL6|A Chain A, Structure Of Unphosphorylated D274n Mutant Of Aurora-a Length = 282 | Back alignment and structure |
| >pdb|2XRU|A Chain A, Aurora-A T288e Complexed With Pha-828300 Length = 280 | Back alignment and structure |
| >pdb|3UNZ|A Chain A, Aurora A In Complex With Rpm1679 Length = 279 | Back alignment and structure |
| >pdb|3LAU|A Chain A, Crystal Structure Of Aurora2 Kinase In Complex With A Gsk3beta Inhibitor Length = 287 | Back alignment and structure |
| >pdb|3FDN|A Chain A, Structure-Based Drug Design Of Novel Aurora Kinase A Inhibitors: Structure Basis For Potency And Specificity Length = 279 | Back alignment and structure |
| >pdb|2GU8|A Chain A, Discovery Of 2-pyrimidyl-5-amidothiophenes As Novel And Potent Inhibitors For Akt: Synthesis And Sar Studies Length = 337 | Back alignment and structure |
| >pdb|2C6E|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With A 5-Aminopyrimidinyl Quinazoline Inhibitor Length = 283 | Back alignment and structure |
| >pdb|2J50|A Chain A, Structure Of Aurora-2 In Complex With Pha-739358 Length = 280 | Back alignment and structure |
| >pdb|2XNE|A Chain A, Structure Of Aurora-A Bound To An Imidazopyrazine Inhibitor Length = 272 | Back alignment and structure |
| >pdb|1MQ4|A Chain A, Crystal Structure Of Aurora-A Protein Kinase Length = 272 | Back alignment and structure |
| >pdb|2W1D|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|3H0Y|A Chain A, Aurora A In Complex With A Bisanilinopyrimidine Length = 268 | Back alignment and structure |
| >pdb|2C6D|A Chain A, Aurora A Kinase Activated Mutant (T287d) In Complex With Adpnp Length = 275 | Back alignment and structure |
| >pdb|3R21|A Chain A, Design, Synthesis, And Biological Evaluation Of Pyrazolopyridine- Sulfonamides As Potent Multiple-Mitotic Kinase (Mmk) Inhibitors (Part I) Length = 271 | Back alignment and structure |
| >pdb|3O50|A Chain A, Crystal Structure Of Benzamide 9 Bound To Auroraa Length = 267 | Back alignment and structure |
| >pdb|2W1C|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 275 | Back alignment and structure |
| >pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 | Back alignment and structure |
| >pdb|2BUJ|A Chain A, Crystal Structure Of The Human Serine-Threonine Kinase 16 In Complex With Staurosporine Length = 317 | Back alignment and structure |
| >pdb|3HA6|A Chain A, Crystal Structure Of Aurora A In Complex With Tpx2 And Compound 10 Length = 268 | Back alignment and structure |
| >pdb|3COH|A Chain A, Crystal Structure Of Aurora-A In Complex With A Pentacyclic Inhibitor Length = 268 | Back alignment and structure |
| >pdb|3E5A|A Chain A, Crystal Structure Of Aurora A In Complex With Vx-680 And Tpx2 Length = 268 | Back alignment and structure |
| >pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 | Back alignment and structure |
| >pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 | Back alignment and structure |
| >pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 | Back alignment and structure |
| >pdb|3GBZ|A Chain A, Structure Of The Cmgc Cdk Kinase From Giardia Lamblia Length = 329 | Back alignment and structure |
| >pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 | Back alignment and structure |
| >pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 | Back alignment and structure |
| >pdb|3O7L|B Chain B, Crystal Structure Of Phospholamban (1-19):pka C-Subunit:amp-Pnp:mg2+ Complex Length = 350 | Back alignment and structure |
| >pdb|2UVY|A Chain A, Structure Of Pka-pkb Chimera Complexed With Methyl-(4-(9h- Purin-6-yl)-benzyl)-amine Length = 351 | Back alignment and structure |
| >pdb|3PG1|A Chain A, Map Kinase Lmampk10 From Leishmania Major (1.95 Angs Resolution) Length = 362 | Back alignment and structure |
| >pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 | Back alignment and structure |
| >pdb|3MTL|A Chain A, Crystal Structure Of The Pctaire1 Kinase In Complex With Ind E804 Length = 324 | Back alignment and structure |
| >pdb|3UIB|A Chain A, Map Kinase Lmampk10 From Leishmania Major In Complex With Sb203580 Length = 362 | Back alignment and structure |
| >pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 | Back alignment and structure |
| >pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 | Back alignment and structure |
| >pdb|2YCR|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv976 Length = 323 | Back alignment and structure |
| >pdb|2VO0|A Chain A, Structure Of Pka-Pkb Chimera Complexed With C-(4-(4- Chlorophenyl)-1-(7h-Pyrrolo(2, 3-D)pyrimidin-4-Yl)piperidin- 4-Yl)methylamine Length = 351 | Back alignment and structure |
| >pdb|2JDT|A Chain A, Structure Of Pka-Pkb Chimera Complexed With Isoquinoline-5- Sulfonic Acid (2-(2-(4-Chlorobenzyloxy) Ethylamino)ethyl) Amide Length = 351 | Back alignment and structure |
| >pdb|2YCF|A Chain A, Crystal Structure Of Checkpoint Kinase 2 In Complex With Inhibitor Pv1531 Length = 322 | Back alignment and structure |
| >pdb|2CN5|A Chain A, Crystal Structure Of Human Chk2 In Complex With Adp Length = 329 | Back alignment and structure |
| >pdb|2W0J|A Chain A, Crystal Structure Of Chk2 In Complex With Nsc 109555, A Specific Inhibitor Length = 323 | Back alignment and structure |
| >pdb|2XK9|A Chain A, Structural Analysis Of Checkpoint Kinase 2 (Chk2) In Complex With Inhibitor Pv1533 Length = 322 | Back alignment and structure |
| >pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 | Back alignment and structure |
| >pdb|3L9M|A Chain A, Crystal Structure Of Pkab3 (Pka Triple Mutant V123a, L173m, Q181k) With Compound 18 Length = 351 | Back alignment and structure |
| >pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 | Back alignment and structure |
| >pdb|2VWI|A Chain A, Structure Of The Osr1 Kinase, A Hypertension Drug Target Length = 303 | Back alignment and structure |
| >pdb|1TKI|A Chain A, Autoinhibited Serine Kinase Domain Of The Giant Muscle Protein Titin Length = 321 | Back alignment and structure |
| >pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 | Back alignment and structure |
| >pdb|2W4O|A Chain A, Crystal Structure Of Human Camk4 In Complex With 4-Amino( Sulfamoyl-Phenylamino)-Triazole-Carbothioic Acid (2,6- Difluoro-Phenyl)-Amide) Length = 349 | Back alignment and structure |
| >pdb|2WQE|A Chain A, Structure Of S155r Aurora-A Somatic Mutant Length = 262 | Back alignment and structure |
| >pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 | Back alignment and structure |
| >pdb|3DAK|A Chain A, Crystal Structure Of Domain-Swapped Osr1 Kinase Domain Length = 290 | Back alignment and structure |
| >pdb|3RGF|A Chain A, Crystal Structure Of Human Cdk8CYCC Length = 405 | Back alignment and structure |
| >pdb|4E4M|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|1KOB|A Chain A, Twitchin Kinase Fragment (Aplysia), Autoregulated Protein Kinase Domain Length = 387 | Back alignment and structure |
| >pdb|3TJC|A Chain A, Co-Crystal Structure Of Jak2 With Thienopyridine 8 Length = 298 | Back alignment and structure |
| >pdb|2W1I|A Chain A, Structure Determination Of Aurora Kinase In Complex With Inhibitor Length = 326 | Back alignment and structure |
| >pdb|3P23|A Chain A, Crystal Structure Of The Human Kinase And Rnase Domains In Complex With Adp Length = 432 | Back alignment and structure |
| >pdb|4HGE|A Chain A, Jak2 Kinase (Jh1 Domain) In Complex With Compound 8 Length = 300 | Back alignment and structure |
| >pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 | Back alignment and structure |
| >pdb|3IO7|A Chain A, 2-Aminopyrazolo[1,5-A]pyrimidines As Potent And Selective Inhibitors Of Jak2 Length = 313 | Back alignment and structure |
| >pdb|3LPB|A Chain A, Crystal Structure Of Jak2 Complexed With A Potent 2,8-Diaryl Quinoxaline Inhibitor Length = 295 | Back alignment and structure |
| >pdb|2WTV|A Chain A, Aurora-A Inhibitor Structure Length = 285 | Back alignment and structure |
| >pdb|4AQC|A Chain A, Triazolopyridine-Based Inhibitor Of Janus Kinase 2 Length = 301 | Back alignment and structure |
| >pdb|3RVG|A Chain A, Crystals Structure Of Jak2 With A 1-Amino-5h-Pyrido[4,3-B]indol-4- Carboxamide Inhibitor Length = 303 | Back alignment and structure |
| >pdb|3Q32|A Chain A, Structure Of Janus Kinase 2 With A Pyrrolotriazine Inhibitor Length = 301 | Back alignment and structure |
| >pdb|2B7A|A Chain A, The Structural Basis Of Janus Kinase 2 Inhibition By A Potent And Specific Pan-Janus Kinase Inhibitor Length = 293 | Back alignment and structure |
| >pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 | Back alignment and structure |
| >pdb|3E62|A Chain A, Fragment Based Discovery Of Jak-2 Inhibitors Length = 293 | Back alignment and structure |
| >pdb|2WTW|A Chain A, Aurora-A Inhibitor Structure (2nd Crystal Form) Length = 285 | Back alignment and structure |
| >pdb|4E6D|A Chain A, Jak2 Kinase (Jh1 Domain) Triple Mutant In Complex With Compound 7 Length = 298 | Back alignment and structure |
| >pdb|3UGC|A Chain A, Structural Basis Of Jak2 Inhibition By The Type Ii Inhibtor Nvp-Bbt594 Length = 295 | Back alignment and structure |
| >pdb|3JY9|A Chain A, Janus Kinase 2 Inhibitors Length = 311 | Back alignment and structure |
| >pdb|3PPZ|A Chain A, Crystal Structure Of Ctr1 Kinase Domain In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3I6U|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 419 | Back alignment and structure |
| >pdb|3I6W|A Chain A, Structure And Activation Mechanism Of The Chk2 Dna-Damage Checkpoint Kinase Length = 443 | Back alignment and structure |
| >pdb|2DYL|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 7 Activated Mutant (S287d, T291d) Length = 318 | Back alignment and structure |
| >pdb|1NA7|A Chain A, Crystal Structure Of The Catalytic Subunit Of Human Protein Kinase Ck2 Length = 329 | Back alignment and structure |
| >pdb|3TXO|A Chain A, Pkc Eta Kinase In Complex With A Naphthyridine Length = 353 | Back alignment and structure |
| >pdb|4GSB|A Chain A, Monoclinic Crystal Form Of The Apo-Erk2 Length = 364 | Back alignment and structure |
| >pdb|1PME|A Chain A, Structure Of Penta Mutant Human Erk2 Map Kinase Complexed With A Specific Inhibitor Of Human P38 Map Kinase Length = 380 | Back alignment and structure |
| >pdb|1FOT|A Chain A, Structure Of The Unliganded Camp-Dependent Protein Kinase Catalytic Subunit From Saccharomyces Cerevisiae Length = 318 | Back alignment and structure |
| >pdb|2W96|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|1U5Q|A Chain A, Crystal Structure Of The Tao2 Kinase Domain: Activation And Specifity Of A Ste20p Map3k Length = 348 | Back alignment and structure |
| >pdb|4FIE|A Chain A, Full-Length Human Pak4 Length = 423 | Back alignment and structure |
| >pdb|2W99|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|4H3Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|4FR4|A Chain A, Crystal Structure Of Human SerineTHREONINE-Protein Kinase 32a (Yank1) Length = 384 | Back alignment and structure |
| >pdb|2W9F|B Chain B, Crystal Structure Of Cdk4 In Complex With A D-Type Cyclin Length = 306 | Back alignment and structure |
| >pdb|3RP9|A Chain A, Crystal Structure Of The Apo Mapk From Toxoplasma Gondii, 25.M01780 Or Tgme49_007820 Length = 458 | Back alignment and structure |
| >pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 | Back alignment and structure |
| >pdb|3TEI|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 | Back alignment and structure |
| >pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 | Back alignment and structure |
| >pdb|4APC|A Chain A, Crystal Structure Of Human Nima-Related Kinase 1 (Nek1) Length = 350 | Back alignment and structure |
| >pdb|2GCD|A Chain A, Tao2 Kinase Domain-Staurosporine Structure Length = 309 | Back alignment and structure |
| >pdb|3SA0|A Chain A, Complex Of Erk2 With Norathyriol Length = 360 | Back alignment and structure |
| >pdb|2XA4|A Chain A, Inhibitors Of Jak2 Kinase Domain Length = 298 | Back alignment and structure |
| >pdb|2WEL|A Chain A, Crystal Structure Of Su6656-Bound CalciumCALMODULIN- Dependent Protein Kinase Ii Delta In Complex With Calmodulin Length = 327 | Back alignment and structure |
| >pdb|4FIF|A Chain A, Catalytic Domain Of Human Pak4 With Rpkplvdp Peptide Length = 346 | Back alignment and structure |
| >pdb|4FV7|A Chain A, Crystal Structure Of The Erk2 Complexed With E94 Length = 360 | Back alignment and structure |
| >pdb|1WZY|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Pyrazolopyridazine Derivative Length = 368 | Back alignment and structure |
| >pdb|1TVO|A Chain A, The Structure Of Erk2 In Complex With A Small Molecule Inhibitor Length = 368 | Back alignment and structure |
| >pdb|2OJG|A Chain A, Crystal Structure Of Erk2 In Complex With N,n-dimethyl-4-(4- Phenyl-1h-pyrazol-3-yl)-1h-pyrrole-2-carboxamide Length = 380 | Back alignment and structure |
| >pdb|4FUX|A Chain A, Crystal Structure Of The Erk2 Complexed With E75 Length = 360 | Back alignment and structure |
| >pdb|3QYW|A Chain A, Crystal Structure Of Erk2 In Complex With An Inhibitor Length = 364 | Back alignment and structure |
| >pdb|2CDZ|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Cgp74514a Length = 303 | Back alignment and structure |
| >pdb|2Y9Q|A Chain A, Crystal Structure Of Human Erk2 Complexed With A Mapk Docking Peptide Length = 362 | Back alignment and structure |
| >pdb|3ZUV|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2ERK|A Chain A, Phosphorylated Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|3ZU7|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 365 | Back alignment and structure |
| >pdb|3R63|A Chain A, Structure Of Erk2 (Spe) Mutant (S246e) Length = 358 | Back alignment and structure |
| >pdb|2Z7L|A Chain A, Unphosphorylated Mitogen Activated Protein Kinase Erk2 In Complex With (4-{[5-Carbamoyl-4-(3-Methylanilino)pyrimidin 2-Yl]amino}phenyl)acetic Acid Length = 366 | Back alignment and structure |
| >pdb|3C9W|A Chain A, Crystal Structure Of Erk-2 With Hypothemycin Covalently Bound Length = 357 | Back alignment and structure |
| >pdb|2FYS|B Chain B, Crystal Structure Of Erk2 Complex With Kim Peptide Derived From Mkp3 Length = 364 | Back alignment and structure |
| >pdb|4FV6|A Chain A, Crystal Structure Of The Erk2 Complexed With E57 Length = 360 | Back alignment and structure |
| >pdb|3P86|A Chain A, Crystal Structure Of Ctr1 Kinase Domain Mutant D676n In Complex With Staurosporine Length = 309 | Back alignment and structure |
| >pdb|3O71|A Chain A, Crystal Structure Of Erk2DCC PEPTIDE COMPLEX Length = 358 | Back alignment and structure |
| >pdb|2BVA|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 Length = 292 | Back alignment and structure |
| >pdb|3COM|A Chain A, Crystal Structure Of Mst1 Kinase Length = 314 | Back alignment and structure |
| >pdb|2Q0N|A Chain A, Structure Of Human P21 Activating Kinase 4 (Pak4) In Complex With A Consensus Peptide Length = 301 | Back alignment and structure |
| >pdb|2X4Z|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 4 In Complex With Pf-03758309 Length = 296 | Back alignment and structure |
| >pdb|4BBE|A Chain A, Aminoalkylpyrimidine Inhibitor Complexes With Jak2 Length = 298 | Back alignment and structure |
| >pdb|2R5T|A Chain A, Crystal Structure Of Inactive Serum And Glucocorticoid- Regulated Kinase 1 In Complex With Amp-Pnp Length = 373 | Back alignment and structure |
| >pdb|2VN9|A Chain A, Crystal Structure Of Human Calcium Calmodulin Dependent Protein Kinase Ii Delta Isoform 1, Camkd Length = 301 | Back alignment and structure |
| >pdb|1UA2|A Chain A, Crystal Structure Of Human Cdk7 Length = 346 | Back alignment and structure |
| >pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 | Back alignment and structure |
| >pdb|3H4J|B Chain B, Crystal Structure Of Pombe Ampk Kdaid Fragment Length = 336 | Back alignment and structure |
| >pdb|2PK9|A Chain A, Structure Of The Pho85-pho80 Cdk-cyclin Complex Of The Phosphate-responsive Signal Transduction Pathway Length = 317 | Back alignment and structure |
| >pdb|3G33|A Chain A, Crystal Structure Of Cdk4CYCLIN D3 Length = 308 | Back alignment and structure |
| >pdb|4GS6|A Chain A, Irreversible Inhibition Of Tak1 Kinase By 5z-7-oxozeaenol Length = 315 | Back alignment and structure |
| >pdb|2VRX|A Chain A, Structure Of Aurora B Kinase In Complex With Zm447439 Length = 285 | Back alignment and structure |
| >pdb|2GPH|A Chain A, Docking Motif Interactions In The Map Kinase Erk2 Length = 364 | Back alignment and structure |
| >pdb|2BFY|A Chain A, Complex Of Aurora-B With Incenp And Hesperidin. Length = 284 | Back alignment and structure |
| >pdb|2EVA|A Chain A, Structural Basis For The Interaction Of Tak1 Kinase With Its Activating Protein Tab1 Length = 307 | Back alignment and structure |
| >pdb|1GOL|A Chain A, Coordinates Of Rat Map Kinase Erk2 With An Arginine Mutation At Position 52 Length = 364 | Back alignment and structure |
| >pdb|3LL6|A Chain A, Crystal Structure Of The Human Cyclin G Associated Kinase (gak) Length = 337 | Back alignment and structure |
| >pdb|2J7T|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Su11274 Length = 302 | Back alignment and structure |
| >pdb|4BC6|A Chain A, Crystal Structure Of Human Serine Threonine Kinase-10 Bound To Novel Bosutinib Isoform 1, Previously Thought To Be Bosutinib Length = 293 | Back alignment and structure |
| >pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 | Back alignment and structure |
| >pdb|3A62|A Chain A, Crystal Structure Of Phosphorylated P70s6k1 Length = 327 | Back alignment and structure |
| >pdb|3A60|A Chain A, Crystal Structure Of Unphosphorylated P70s6k1 (Form I) Length = 327 | Back alignment and structure |
| >pdb|1VZO|A Chain A, The Structure Of The N-Terminal Kinase Domain Of Msk1 Reveals A Novel Autoinhibitory Conformation For A Dual Kinase Protein Length = 355 | Back alignment and structure |
| >pdb|3S95|A Chain A, Crystal Structure Of The Human Limk1 Kinase Domain In Complex With Staurosporine Length = 310 | Back alignment and structure |
| >pdb|4G31|A Chain A, Crystal Structure Of Gsk6414 Bound To Perk (R587-R1092, Delete A660- T867) At 2.28 A Resolution Length = 299 | Back alignment and structure |
| >pdb|3FI3|A Chain A, Crystal Structure Of Jnk3 With Indazole Inhibitor, Sr-3737 Length = 364 | Back alignment and structure |
| >pdb|4H1J|A Chain A, Crystal Structure Of Pyk2 With The Pyrazole 13a Length = 293 | Back alignment and structure |
| >pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 | Back alignment and structure |
| >pdb|3KVX|A Chain A, Jnk3 Bound To Aminopyrimidine Inhibitor, Sr-3562 Length = 364 | Back alignment and structure |
| >pdb|4AZF|A Chain A, Human Dyrk2 In Complex With Leucettine L41 Length = 417 | Back alignment and structure |
| >pdb|3KVW|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) In Complex With An Indirubin Ligand Length = 429 | Back alignment and structure |
| >pdb|3LXN|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 318 | Back alignment and structure |
| >pdb|3ZUU|A Chain A, The Structure Of Ost1 (D160a, S175d) Kinase In Complex With Gold Length = 362 | Back alignment and structure |
| >pdb|3CC6|A Chain A, Crystal Structure Of Kinase Domain Of Protein Tyrosine Kinase 2 Beta (ptk2b) Length = 281 | Back alignment and structure |
| >pdb|3ZUT|A Chain A, The Structure Of Ost1 (D160a) Kinase Length = 362 | Back alignment and structure |
| >pdb|2R9S|A Chain A, C-Jun N-Terminal Kinase 3 With 3,5-Disubstituted Quinoline Inhibitor Length = 356 | Back alignment and structure |
| >pdb|3UJG|A Chain A, Crystal Structure Of Snrk2.6 In Complex With Hab1 Length = 361 | Back alignment and structure |
| >pdb|3VN9|A Chain A, Rifined Crystal Structure Of Non-Phosphorylated Map2k6 In A Putative Auto-Inhibition State Length = 340 | Back alignment and structure |
| >pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 | Back alignment and structure |
| >pdb|3UC4|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.6 Length = 362 | Back alignment and structure |
| >pdb|2YZA|A Chain A, Crystal Structure Of Kinase Domain Of Human 5'-Amp-Activated Protein Kinase Alpha-2 Subunit Mutant (T172d) Length = 276 | Back alignment and structure |
| >pdb|2H6D|A Chain A, Protein Kinase Domain Of The Human 5'-Amp-Activated Protein Kinase Catalytic Subunit Alpha-2 (Ampk Alpha-2 Chain) Length = 276 | Back alignment and structure |
| >pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 | Back alignment and structure |
| >pdb|3FZO|A Chain A, Crystal Structure Of Pyk2-Apo, Proline-Rich Tyrosine Kinase Length = 277 | Back alignment and structure |
| >pdb|2A19|B Chain B, Pkr Kinase Domain- Eif2alpha- Amp-Pnp Complex. Length = 284 | Back alignment and structure |
| >pdb|3FME|A Chain A, Crystal Structure Of Human Mitogen-Activated Protein Kinase Kinase 6 (Mek6) Activated Mutant (S207d, T211d) Length = 290 | Back alignment and structure |
| >pdb|3FV8|A Chain A, Jnk3 Bound To Piperazine Amide Inhibitor, Sr2774 Length = 355 | Back alignment and structure |
| >pdb|3E7O|A Chain A, Crystal Structure Of Jnk2 Length = 360 | Back alignment and structure |
| >pdb|4EC8|A Chain A, Structure Of Full Length Cdk9 In Complex With Cyclint And Drb Length = 373 | Back alignment and structure |
| >pdb|3VUM|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M7 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3NZ0|A Chain A, Non-Phosphorylated Tyk2 Kinase With Cmp6 Length = 302 | Back alignment and structure |
| >pdb|3NYX|A Chain A, Non-Phosphorylated Tyk2 Jh1 Domain With Quinoline-Thiadiazole- Thiophene Inhibitor Length = 302 | Back alignment and structure |
| >pdb|3F69|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Pknb Mutant Kinase Domain In Complex With Kt5720 Length = 311 | Back alignment and structure |
| >pdb|3N9X|A Chain A, Crystal Structure Of Map Kinase From Plasmodium Berghei, Pb000659.00.0 Length = 432 | Back alignment and structure |
| >pdb|3MI9|A Chain A, Crystal Structure Of Hiv-1 Tat Complexed With Human P-Tefb Length = 351 | Back alignment and structure |
| >pdb|4BCF|A Chain A, Structure Of Cdk9 In Complex With Cyclin T And A 2-amino-4- Heteroaryl-pyrimidine Inhibitor Length = 331 | Back alignment and structure |
| >pdb|3TTJ|A Chain A, Crystal Structure Of Jnk3 Complexed With Cc-359, A Jnk Inhibitor For The Prevention Of Ischemia-Reperfusion Injury Length = 464 | Back alignment and structure |
| >pdb|4FSZ|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|1ZRZ|A Chain A, Crystal Structure Of The Catalytic Domain Of Atypical Protein Kinase C-Iota Length = 364 | Back alignment and structure |
| >pdb|3NPC|A Chain A, Crystal Structure Of Jnk2 Complexed With Birb796 Length = 364 | Back alignment and structure |
| >pdb|3BLH|A Chain A, Crystal Structure Of Human Cdk9CYCLINT1 Length = 331 | Back alignment and structure |
| >pdb|2VZ6|A Chain A, Structure Of Human Calcium Calmodulin Dependent Protein Kinase Type Ii Alpha (Camk2a) In Complex With Indirubin E804 Length = 313 | Back alignment and structure |
| >pdb|2YDJ|A Chain A, Discovery Of Checkpoint Kinase Inhibitor Azd7762 By Structure Based Design And Optimization Of Thiophene Carboxamide Ureas Length = 276 | Back alignment and structure |
| >pdb|3KN5|A Chain A, Crystal Structure Of The C-Terminal Kinase Domain Of Msk1 In With Amp-Pnp Length = 325 | Back alignment and structure |
| >pdb|2R0U|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 54 Length = 323 | Back alignment and structure |
| >pdb|2HOG|A Chain A, Crystal Structure Of Chek1 In Complex With Inhibitor 20 Length = 322 | Back alignment and structure |
| >pdb|4FSY|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|1PMN|A Chain A, Crystal Structure Of Jnk3 In Complex With An Imidazole- Pyrimidine Inhibitor Length = 364 | Back alignment and structure |
| >pdb|2OK1|A Chain A, Crystal Structure Of Jnk3 Bound To N-Benzyl-4-(4-(3- Chlorophenyl)-1h-Pyrazol-3-Yl)-1h-Pyrrole-2-Carboxamide Length = 365 | Back alignment and structure |
| >pdb|3PTG|A Chain A, Design And Synthesis Of A Novel, Orally Efficacious Tri-Substituted Thiophene Based Jnk Inhibitor Length = 363 | Back alignment and structure |
| >pdb|2O0U|A Chain A, Crystal Structure Of Human Jnk3 Complexed With N-{3-Cyano-6-[3-(1- Piperidinyl)propanoyl]-4,5,6,7-Tetrahydrothieno[2, 3-C]pyridin-2-Yl}- 1-Naphthalenecarboxamide Length = 364 | Back alignment and structure |
| >pdb|3SDJ|A Chain A, Structure Of Rnase-Inactive Point Mutant Of Oligomeric KinaseRNASE Ire1 Length = 448 | Back alignment and structure |
| >pdb|3F61|A Chain A, Crystal Structure Of M. Tuberculosis Pknb Leu33aspVAL222ASP DOUBLE MUTANT IN COMPLEX WITH ADP Length = 311 | Back alignment and structure |
| >pdb|4DC2|A Chain A, Structure Of Pkc In Complex With A Substrate Peptide From Par-3 Length = 396 | Back alignment and structure |
| >pdb|3OXI|A Chain A, Design And Synthesis Of Disubstituted Thiophene And Thiazole Based Inhibitors Of Jnk For The Treatment Of Neurodegenerative Diseases Length = 362 | Back alignment and structure |
| >pdb|1JNK|A Chain A, The C-Jun N-Terminal Kinase (Jnk3s) Complexed With Mgamp-Pnp Length = 423 | Back alignment and structure |
| >pdb|2EXC|X Chain X, Inhibitor Complex Of Jnk3 Length = 356 | Back alignment and structure |
| >pdb|3K2L|A Chain A, Crystal Structure Of Dual-Specificity Tyrosine Phosphorylation Regulated Kinase 2 (Dyrk2) Length = 429 | Back alignment and structure |
| >pdb|3FI2|A Chain A, Crystal Structure Of Jnk3 With Amino-Pyrazole Inhibitor, Sr- 3451 Length = 353 | Back alignment and structure |
| >pdb|3FBV|A Chain A, Crystal Structure Of The Oligomer Formed By The Kinase-Ribonuclease Domain Of Ire1 Length = 448 | Back alignment and structure |
| >pdb|3ZH8|A Chain A, A Novel Small Molecule Apkc Inhibitor Length = 349 | Back alignment and structure |
| >pdb|4H36|A Chain A, Crystal Structure Of Jnk3 In Complex With Atf2 Peptide Length = 356 | Back alignment and structure |
| >pdb|3ORI|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain L33d Mutant (Crystal Form 1) Length = 311 | Back alignment and structure |
| >pdb|2VD5|A Chain A, Structure Of Human Myotonic Dystrophy Protein Kinase In Complex With The Bisindoylmaleide Inhibitor Bim Viii Length = 412 | Back alignment and structure |
| >pdb|2B1P|A Chain A, Inhibitor Complex Of Jnk3 Length = 355 | Back alignment and structure |
| >pdb|3MFR|A Chain A, Cask-4m Cam Kinase Domain, Native Length = 351 | Back alignment and structure |
| >pdb|2BR1|A Chain A, Structure-Based Design Of Novel Chk1 Inhibitors: Insights Into Hydrogen Bonding And Protein-Ligand Affinity Length = 297 | Back alignment and structure |
| >pdb|1IA8|A Chain A, The 1.7 A Crystal Structure Of Human Cell Cycle Checkpoint Kinase Chk1 Length = 289 | Back alignment and structure |
| >pdb|1ZLT|A Chain A, Crystal Structure Of Chk1 Complexed With A Hymenaldisine Analog Length = 295 | Back alignment and structure |
| >pdb|3VUL|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3A8W|A Chain A, Crystal Structure Of Pkciota Kinase Domain Length = 345 | Back alignment and structure |
| >pdb|4FT3|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2WTK|C Chain C, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 305 | Back alignment and structure |
| >pdb|3VUK|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M5 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|2RIO|A Chain A, Structure Of The Dual Enzyme Ire1 Reveals The Basis For Catalysis And Regulation Of Non-conventional Splicing Length = 434 | Back alignment and structure |
| >pdb|1MRU|A Chain A, Intracellular SerTHR PROTEIN KINASE DOMAIN OF Mycobacterium Tuberculosis Pknb. Length = 311 | Back alignment and structure |
| >pdb|3LJ0|A Chain A, Ire1 Complexed With Adp And Quercetin Length = 434 | Back alignment and structure |
| >pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 | Back alignment and structure |
| >pdb|4FSW|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2PML|X Chain X, Crystal Structure Of Pfpk7 In Complex With An Atp Analogue Length = 348 | Back alignment and structure |
| >pdb|3BHH|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase Iib Isoform 1 (camk2b) Length = 295 | Back alignment and structure |
| >pdb|4FSN|A Chain A, Crystal Structure Of The Chk1 Length = 278 | Back alignment and structure |
| >pdb|3Q5I|A Chain A, Crystal Structure Of Pbanka_031420 Length = 504 | Back alignment and structure |
| >pdb|4FSM|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|3ORM|A Chain A, Mycobacterium Tuberculosis Pknb Kinase Domain D76a Mutant Length = 311 | Back alignment and structure |
| >pdb|3OT3|A Chain A, X-Ray Crystal Structure Of Compound 22k Bound To Human Chk1 Kinase Domain Length = 273 | Back alignment and structure |
| >pdb|4FST|A Chain A, Crystal Structure Of The Chk1 Length = 269 | Back alignment and structure |
| >pdb|2X8E|A Chain A, Discovery Of A Novel Class Of Triazolones As Checkpoint Kinase Inhibitors - Hit To Lead Exploration Length = 276 | Back alignment and structure |
| >pdb|3JVR|A Chain A, Characterization Of The Chk1 Allosteric Inhibitor Binding Site Length = 271 | Back alignment and structure |
| >pdb|2CLQ|A Chain A, Structure Of Mitogen-Activated Protein Kinase Kinase Kinase 5 Length = 295 | Back alignment and structure |
| >pdb|3VUI|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|4E1Z|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 291 | Back alignment and structure |
| >pdb|3UIU|A Chain A, Crystal Structure Of Apo-Pkr Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|4E20|A Chain A, Structure Of Mouse Tyk-2 Complexed To A 3-Aminoindazole Inhibitor Length = 290 | Back alignment and structure |
| >pdb|2GHG|A Chain A, H-Chk1 Complexed With A431994 Length = 269 | Back alignment and structure |
| >pdb|1O6Y|A Chain A, Catalytic Domain Of Pknb Kinase From Mycobacterium Tuberculosis Length = 299 | Back alignment and structure |
| >pdb|2E9V|A Chain A, Structure Of H-Chk1 Complexed With A859017 Length = 268 | Back alignment and structure |
| >pdb|2AYP|A Chain A, Crystal Structure Of Chk1 With An Indol Inhibitor Length = 269 | Back alignment and structure |
| >pdb|2QR7|A Chain A, 2.0a X-Ray Structure Of C-Terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2: Se-Met Derivative Length = 342 | Back alignment and structure |
| >pdb|2QR8|A Chain A, 2.0a X-ray Structure Of C-terminal Kinase Domain Of P90 Ribosomal S6 Kinase 2 (rsk2) Length = 342 | Back alignment and structure |
| >pdb|1OB3|A Chain A, Structure Of P. Falciparum Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0B|A Chain A, Crystal Structure Of The T198a Mutant Of Pfpk5 Length = 288 | Back alignment and structure |
| >pdb|1V0O|A Chain A, Structure Of P. Falciparum Pfpk5-Indirubin-5-Sulphonate Ligand Complex Length = 288 | Back alignment and structure |
| >pdb|2J51|A Chain A, Crystal Structure Of Human Ste20-Like Kinase Bound To 5- Amino-3-((4-(Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2,4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|2JFM|A Chain A, Crystal Structure Of Human Ste20-Like Kinase (Unliganded Form) Length = 325 | Back alignment and structure |
| >pdb|2JFL|A Chain A, Crystal Structure Of Human Ste20-Like Kinase ( Diphosphorylated Form) Bound To 5- Amino-3-((4-( Aminosulfonyl)phenyl)amino)-N-(2,6- Difluorophenyl)-1h-1,2, 4-Triazole-1-Carbothioamide Length = 325 | Back alignment and structure |
| >pdb|3VW6|A Chain A, Crystal Structure Of Human Apoptosis Signal-Regulating Kinase 1 (Ask1) With Imidazopyridine Inhibitor Length = 269 | Back alignment and structure |
| >pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 | Back alignment and structure |
| >pdb|1WBP|A Chain A, Srpk1 Bound To 9mer Docking Motif Peptide Length = 397 | Back alignment and structure |
| >pdb|3VUH|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M3 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1YHV|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Two Point Mutations (K299r, T423e) Length = 297 | Back alignment and structure |
| >pdb|2XS0|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 386 | Back alignment and structure |
| >pdb|1F3M|C Chain C, Crystal Structure Of Human SerineTHREONINE KINASE PAK1 Length = 297 | Back alignment and structure |
| >pdb|3Q52|A Chain A, Structure Of Phosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3FXZ|A Chain A, Crystal Structure Of Pak1 Kinase Domain With Ruthenium Complex Lambda-Fl172 Length = 297 | Back alignment and structure |
| >pdb|3VUG|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M2 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|1ZYS|A Chain A, Co-Crystal Structure Of Checkpoint Kinase Chk1 With A Pyrrolo-Pyridine Inhibitor Length = 273 | Back alignment and structure |
| >pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 | Back alignment and structure |
| >pdb|3BEG|A Chain A, Crystal Structure Of Sr Protein Kinase 1 Complexed To Its Substrate AsfSF2 Length = 381 | Back alignment and structure |
| >pdb|3VUD|A Chain A, Crystal Structure Of A Cysteine-deficient Mutant M1 In Map Kinase Jnk1 Length = 370 | Back alignment and structure |
| >pdb|3V3V|A Chain A, Structural And Functional Analysis Of Quercetagetin, A Natural Jnk1 Inhibitor Length = 379 | Back alignment and structure |
| >pdb|3UDB|A Chain A, Crystal Structure Of Snrk2.6 Length = 317 | Back alignment and structure |
| >pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 | Back alignment and structure |
| >pdb|1YVJ|A Chain A, Crystal Structure Of The Jak3 Kinase Domain In Complex With A Staurosporine Analogue Length = 290 | Back alignment and structure |
| >pdb|1UKH|A Chain A, Structural Basis For The Selective Inhibition Of Jnk1 By The Scaffolding Protein Jip1 And Sp600125 Length = 369 | Back alignment and structure |
| >pdb|2XRW|A Chain A, Linear Binding Motifs For Jnk And For Calcineurin Antagonistically Control The Nuclear Shuttling Of Nfat4 Length = 371 | Back alignment and structure |
| >pdb|2Y4I|C Chain C, Ksr2-Mek1 Heterodimer Length = 395 | Back alignment and structure |
| >pdb|4FSU|A Chain A, Crystal Structure Of The Chk1 Length = 279 | Back alignment and structure |
| >pdb|2X7G|A Chain A, Structure Of Human Serine-Arginine-Rich Protein-Specific Kinase 2 (Srpk2) Bound To Purvalanol B Length = 389 | Back alignment and structure |
| >pdb|4AF3|A Chain A, Human Aurora B Kinase In Complex With Incenp And Vx-680 Length = 292 | Back alignment and structure |
| >pdb|3ELJ|A Chain A, Jnk1 Complexed With A Bis-Anilino-Pyrrolopyrimidine Inhibitor Length = 369 | Back alignment and structure |
| >pdb|3O17|A Chain A, Crystal Structure Of Jnk1-Alpha1 Isoform Length = 370 | Back alignment and structure |
| >pdb|2G01|A Chain A, Pyrazoloquinolones As Novel, Selective Jnk1 Inhibitors Length = 370 | Back alignment and structure |
| >pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 | Back alignment and structure |
| >pdb|3ANQ|A Chain A, Human Dyrk1aINHIBITOR COMPLEX Length = 368 | Back alignment and structure |
| >pdb|2VX3|A Chain A, Crystal Structure Of The Human Dual Specificity Tyrosine- Phosphorylation-Regulated Kinase 1a Length = 382 | Back alignment and structure |
| >pdb|4AZE|A Chain A, Human Dyrk1a In Complex With Leucettine L41 Length = 382 | Back alignment and structure |
| >pdb|3PZE|A Chain A, Jnk1 In Complex With Inhibitor Length = 358 | Back alignment and structure |
| >pdb|2WEI|A Chain A, Crystal Structure Of The Kinase Domain Of Cryptosporidium Parvum Calcium Dependent Protein Kinase In Complex With 3- Mb-Pp1 Length = 287 | Back alignment and structure |
| >pdb|3DFA|A Chain A, Crystal Structure Of Kinase Domain Of Calcium-dependent Protein Kinase Cgd3_920 From Cryptosporidium Parvum Length = 286 | Back alignment and structure |
| >pdb|4HVD|A Chain A, Jak3 Kinase Domain In Complex With 2-cyclopropyl-5h-pyrrolo[2,3- B]pyrazine-7-carboxylic Acid ((s)-1,2,2-trimethyl-propyl)-amide Length = 314 | Back alignment and structure |
| >pdb|3LXK|A Chain A, Structural And Thermodynamic Characterization Of The Tyk2 And Jak3 Kinase Domains In Complex With Cp-690550 And Cmp-6 Length = 327 | Back alignment and structure |
| >pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 | Back alignment and structure |
| >pdb|3PJC|A Chain A, Crystal Structure Of Jak3 Complexed With A Potent Atp Site Inhibitor Showing High Selectivity Within The Janus Kinase Family Length = 315 | Back alignment and structure |
| >pdb|3SOA|A Chain A, Full-Length Human Camkii Length = 444 | Back alignment and structure |
| >pdb|3EQC|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Ternary Complex With Compound 1, Atp-Gs And Mg2p Length = 360 | Back alignment and structure |
| >pdb|2BDW|A Chain A, Crystal Structure Of The Auto-Inhibited Kinase Domain Of CalciumCALMODULIN ACTIVATED KINASE II Length = 362 | Back alignment and structure |
| >pdb|3NIE|A Chain A, Crystal Structure Of Pf11_0147 Length = 429 | Back alignment and structure |
| >pdb|3ORN|A Chain A, Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In Complex With Ch4987655 And Mgamp-Pnp Length = 307 | Back alignment and structure |
| >pdb|2V7O|A Chain A, Crystal Structure Of Human Calcium-Calmodulin-Dependent Protein Kinase Ii Gamma Length = 336 | Back alignment and structure |
| >pdb|1S9J|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 341 | Back alignment and structure |
| >pdb|4AN2|A Chain A, Crystal Structures Of Human Mek1 With Carboxamide-Based Allosteric Inhibitor Xl518 (Gdc-0973), Or Related Analogs. Length = 301 | Back alignment and structure |
| >pdb|2P55|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek1) In A Complex With Ligand And Mgatp Length = 333 | Back alignment and structure |
| >pdb|4EUU|A Chain A, Structure Of Bx-795 Complexed With Human Tbk1 Kinase Domain Phosphorylated On Ser172 Length = 319 | Back alignment and structure |
| >pdb|3ALN|A Chain A, Crystal Structure Of Human Non-Phosphorylated Mkk4 Kinase Domain Complexed With Amp-Pnp Length = 327 | Back alignment and structure |
| >pdb|1XJD|A Chain A, Crystal Structure Of Pkc-Theta Complexed With Staurosporine At 2a Resolution Length = 345 | Back alignment and structure |
| >pdb|3JUH|A Chain A, Crystal Structure Of A Mutant Of Human Protein Kinase Ck2alpha With Altered Cosubstrate Specificity Length = 335 | Back alignment and structure |
| >pdb|3MBL|A Chain A, Crystal Structure Of The Human Mitogen-Activated Protein Kinase Kinase 1 (Mek 1) In Complex With Ligand And Mgadp Length = 328 | Back alignment and structure |
| >pdb|3DV3|A Chain A, Mek1 With Pf-04622664 Bound Length = 322 | Back alignment and structure |
| >pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 | Back alignment and structure |
| >pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 | Back alignment and structure |
| >pdb|3ENM|A Chain A, The Structure Of The Map2k Mek6 Reveals An Autoinhibitory Dimer Length = 316 | Back alignment and structure |
| >pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 | Back alignment and structure |
| >pdb|2C30|A Chain A, Crystal Structure Of The Human P21-Activated Kinase 6 Length = 321 | Back alignment and structure |
| >pdb|3RNY|A Chain A, Crystal Structure Of Human Rsk1 C-Terminal Kinase Domain Length = 346 | Back alignment and structure |
| >pdb|2PZI|A Chain A, Crystal Structure Of Protein Kinase Pkng From Mycobacterium Tuberculosis In Complex With Tetrahydrobenzothiophene Ax20017 Length = 681 | Back alignment and structure |
| >pdb|3SLS|A Chain A, Crystal Structure Of Human Mek-1 Kinase In Complex With Ucb1353770 And Amppnp Length = 304 | Back alignment and structure |
| >pdb|2WNT|A Chain A, Crystal Structure Of The Human Ribosomal Protein S6 Kinase Length = 330 | Back alignment and structure |
| >pdb|3Q4Z|A Chain A, Structure Of Unphosphorylated Pak1 Kinase Domain Length = 306 | Back alignment and structure |
| >pdb|3TAC|A Chain A, Crystal Structure Of The Liprin-AlphaCASK COMPLEX Length = 361 | Back alignment and structure |
| >pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 | Back alignment and structure |
| >pdb|1ZYC|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: Wild- Type In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 | Back alignment and structure |
| >pdb|3C0G|A Chain A, Cask Cam-kinase Domain- 3'-amp Complex, P1 Form Length = 351 | Back alignment and structure |
| >pdb|1ZY4|A Chain A, Crystal Structure Of Eif2alpha Protein Kinase Gcn2: R794g Hyperactivating Mutant In Apo Form. Length = 303 | Back alignment and structure |
| >pdb|3O96|A Chain A, Crystal Structure Of Human Akt1 With An Allosteric Inhibitor Length = 446 | Back alignment and structure |
| >pdb|4EJN|A Chain A, Crystal Structure Of Autoinhibited Form Of Akt1 In Complex With N-(4- (5-(3-Acetamidophenyl)-2-(2-Aminopyridin-3-Yl)-3h- Imidazo[4,5- B]pyridin-3-Yl)benzyl)-3-Fluorobenzamide Length = 446 | Back alignment and structure |
| >pdb|2ZV2|A Chain A, Crystal Structure Of Human CalciumCALMODULIN-Dependent Protein Kinase Kinase 2, Beta, Camkk2 Kinase Domain In Complex With Sto-609 Length = 298 | Back alignment and structure |
| >pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 | Back alignment and structure |
| >pdb|3FPQ|A Chain A, Crystal Structure Of The Kinase Domain Of Wnk1 Length = 290 | Back alignment and structure |
| >pdb|3KRW|A Chain A, Human Grk2 In Complex With Gbetgamma Subunits And Balanol (Soak) Length = 688 | Back alignment and structure |
| >pdb|3CIK|A Chain A, Human Grk2 In Complex With Gbetagamma Subunits Length = 689 | Back alignment and structure |
| >pdb|4EUT|A Chain A, Structure Of Bx-795 Complexed With Unphosphorylated Human Tbk1 Kinase- Uld Domain Length = 396 | Back alignment and structure |
| >pdb|4E4L|A Chain A, Jak1 Kinase (Jh1 Domain) In Complex With Compound 30 Length = 302 | Back alignment and structure |
| >pdb|3CQU|A Chain A, Crystal Structure Of Akt-1 Complexed With Substrate Peptide And Inhibitor Length = 342 | Back alignment and structure |
| >pdb|1OMW|A Chain A, Crystal Structure Of The Complex Between G Protein-Coupled Receptor Kinase 2 And Heterotrimeric G Protein Beta 1 And Gamma 2 Subunits Length = 689 | Back alignment and structure |
| >pdb|3PSC|A Chain A, Bovine Grk2 In Complex With Gbetagamma Subunits Length = 695 | Back alignment and structure |
| >pdb|3OCB|A Chain A, Akt1 Kinase Domain With Pyrrolopyrimidine Inhibitor Length = 341 | Back alignment and structure |
| >pdb|4GV1|A Chain A, Pkb Alpha In Complex With Azd5363 Length = 340 | Back alignment and structure |
| >pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 | Back alignment and structure |
| >pdb|2JED|A Chain A, The Crystal Structure Of The Kinase Domain Of The Protein Kinase C Theta In Complex With Nvp-Xaa228 At 2.32a Resolution. Length = 352 | Back alignment and structure |
| >pdb|3EYG|A Chain A, Crystal Structures Of Jak1 And Jak2 Inhibitor Complexes Length = 290 | Back alignment and structure |
| >pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 | Back alignment and structure |
| >pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 | Back alignment and structure |
| >pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 | Back alignment and structure |
| >pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 | Back alignment and structure |
| >pdb|1S9I|A Chain A, X-Ray Structure Of The Human Mitogen-Activated Protein Kinase Kinase 2 (Mek2)in A Complex With Ligand And Mgatp Length = 354 | Back alignment and structure |
| >pdb|1Z57|A Chain A, Crystal Structure Of Human Clk1 In Complex With 10z-Hymenialdisine Length = 339 | Back alignment and structure |
| >pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 | Back alignment and structure |
| >pdb|3GNI|B Chain B, Structure Of Strad And Mo25 Length = 389 | Back alignment and structure |
| >pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 | Back alignment and structure |
| >pdb|2WTK|B Chain B, Structure Of The Heterotrimeric Lkb1-Stradalpha-Mo25alpha Complex Length = 373 | Back alignment and structure |
| >pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 | Back alignment and structure |
| >pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 | Back alignment and structure |
| >pdb|3OFM|A Chain A, Structure Of A Human Ck2alpha Prime, The Paralog Isoform Of The Catalytic Subunit Of Protein Kinase Ck2 From Homo Sapiens Length = 350 | Back alignment and structure |
| >pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 | Back alignment and structure |
| >pdb|2VAG|A Chain A, Crystal Structure Of Di-Phosphorylated Human Clk1 In Complex With A Novel Substituted Indole Inhibitor Length = 339 | Back alignment and structure |
| >pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 | Back alignment and structure |
| >pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 | Back alignment and structure |
| >pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 | Back alignment and structure |
| >pdb|3E3B|X Chain X, Crystal Structure Of Catalytic Subunit Of Human Protein Kinase Ck2alpha Prime With A Potent Indazole-Derivative Inhibitor Length = 339 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 272 | |||
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 4e-86 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 4e-82 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 1e-79 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 2e-71 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 5e-33 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 2e-32 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 3e-31 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 4e-30 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 6e-30 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 7e-30 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 2e-29 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 3e-29 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 4e-29 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 5e-29 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 5e-29 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 6e-29 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 7e-29 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 8e-29 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 9e-29 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 9e-29 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 1e-28 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 1e-28 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 2e-28 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 2e-28 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 2e-28 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 3e-28 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 3e-28 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 4e-28 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 4e-28 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 7e-28 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 9e-28 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 2e-27 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 2e-27 | |
| 4apc_A | 350 | Serine/threonine-protein kinase NEK1; transferase; | 2e-27 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 2e-27 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 3e-27 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 3e-27 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 4e-27 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 8e-27 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 1e-26 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 1e-26 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 1e-26 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 1e-26 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 1e-26 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 2e-26 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 2e-26 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 2e-26 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 3e-26 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 5e-26 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 5e-26 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 5e-26 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 5e-26 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 6e-26 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 7e-26 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 7e-26 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 7e-26 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 9e-26 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 9e-26 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 9e-26 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 9e-26 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 1e-25 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 1e-25 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 1e-25 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 2e-25 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 2e-25 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 2e-25 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 4e-25 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 4e-25 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 5e-25 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 6e-25 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 6e-25 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 8e-25 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 8e-25 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 2e-24 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 2e-24 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 2e-24 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 2e-24 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 3e-24 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 4e-24 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 4e-24 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 4e-24 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 4e-24 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 5e-24 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 5e-24 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 6e-24 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 7e-24 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 8e-24 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 1e-23 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 2e-23 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 2e-23 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 3e-23 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 3e-23 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 3e-23 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 4e-23 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 4e-23 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 5e-23 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 6e-23 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 8e-23 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 1e-22 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 1e-22 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 2e-22 | |
| 1uu3_A | 310 | HPDK1, 3-phosphoinositide dependent protein kinase | 3e-22 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 4e-22 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 4e-22 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 6e-22 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 7e-22 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 2e-21 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 3e-21 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 4e-21 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 5e-21 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 6e-21 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 1e-20 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 2e-20 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 3e-20 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 3e-20 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 3e-20 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 5e-20 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 5e-20 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 6e-20 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 8e-20 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 8e-20 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 9e-20 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 1e-19 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 1e-19 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 1e-19 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 2e-19 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 3e-19 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 3e-19 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 4e-19 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 4e-19 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 9e-19 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 9e-19 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 1e-18 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 1e-18 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 1e-18 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 1e-18 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 2e-18 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 3e-18 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 3e-18 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 8e-18 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 4e-17 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 5e-17 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 5e-17 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 6e-17 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 6e-17 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 7e-17 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 8e-17 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 1e-16 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 1e-16 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 1e-16 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 1e-16 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 1e-16 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 2e-16 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 2e-16 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 3e-16 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 5e-16 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 5e-16 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 1e-15 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 2e-15 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 2e-15 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 2e-15 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 3e-15 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 3e-15 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 3e-15 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 5e-15 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 7e-15 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 8e-15 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 2e-14 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 2e-14 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 5e-14 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 2e-13 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 3e-12 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 6e-12 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 8e-12 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 1e-11 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 1e-11 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 2e-11 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 2e-11 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 3e-11 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 4e-11 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 4e-11 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 5e-11 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 5e-11 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 7e-11 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 9e-11 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 1e-10 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 1e-10 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 1e-10 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 1e-10 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 1e-10 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 2e-10 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-10 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 2e-10 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 2e-10 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 5e-10 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 6e-10 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 7e-10 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 7e-10 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 7e-10 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 8e-10 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 8e-10 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 9e-10 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 1e-09 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 1e-09 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 2e-09 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 2e-09 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 2e-09 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 3e-09 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 3e-09 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 3e-09 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 3e-09 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 4e-09 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 5e-09 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 6e-09 | |
| 3v5q_A | 297 | NT-3 growth factor receptor; kinase domain, kinase | 7e-09 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 1e-08 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 1e-08 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 1e-08 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 1e-08 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 1e-08 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 2e-08 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 2e-08 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 2e-08 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 2e-08 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 3e-08 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 3e-08 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 3e-08 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 4e-08 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 7e-08 | |
| 3zzw_A | 289 | Tyrosine-protein kinase transmembrane receptor RO; | 7e-08 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 8e-08 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 1e-07 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 1e-07 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 2e-07 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 4e-05 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 1e-04 |
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 | Back alignment and structure |
|---|
Score = 262 bits (671), Expect = 4e-86
Identities = 97/207 (46%), Positives = 136/207 (65%), Gaps = 20/207 (9%)
Query: 67 TSEAATVARTERSGFDQLPKEMNEMRIRDEKNVNHDDKDLEPSIVNGNGTEAGQVIATTV 126
+ T + E Q P M++ +K+ G++ V+AT
Sbjct: 2 SGRPRTTSFAESCKPVQQPSAFGSMKVSRDKD----------------GSKVTTVVATP- 44
Query: 127 GGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRL 186
G+ Q +SY +V+G GSFGVV+QAK ++G+ VAIKKVLQDKR+KNRELQIMR
Sbjct: 45 -GQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRK 103
Query: 187 LNHPNVVSLKHCFFSTTEK-DELYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTY 245
L+H N+V L++ F+S+ EK DE+YLNLVL+Y+ ETVYRV++HY+R Q +P++YV+LY Y
Sbjct: 104 LDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY 163
Query: 246 QICRALNYLHHVVGVCHRDIKPQNLLM 272
Q+ R+L Y+H G+CHRDIKPQNLL+
Sbjct: 164 QLFRSLAYIHS-FGICHRDIKPQNLLL 189
|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 | Back alignment and structure |
|---|
| >4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 | Back alignment and structure |
|---|
| >1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Length = 373 | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Length = 360 | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* Length = 429 | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Length = 382 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Length = 355 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Length = 339 | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Length = 397 | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Length = 296 | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Length = 330 | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Length = 298 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Length = 483 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Length = 345 | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Length = 336 | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Length = 364 | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 | Back alignment and structure |
|---|
| >3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 100.0 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 100.0 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 100.0 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 100.0 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 100.0 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 100.0 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.98 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 99.97 | |
| 4g31_A | 299 | Eukaryotic translation initiation factor 2-alpha; | 99.97 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 99.97 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 99.97 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 99.97 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 99.97 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.96 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 99.96 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 99.96 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 99.96 | |
| 3hmm_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.96 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 99.96 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 99.96 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 99.96 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 99.95 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 99.94 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 99.94 | |
| 3o0g_A | 292 | Cell division protein kinase 5; kinase activator c | 99.94 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 99.94 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 99.94 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 99.94 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 99.94 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 99.94 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 99.94 | |
| 3qd2_B | 332 | Eukaryotic translation initiation factor 2-alpha; | 99.94 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 99.94 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 99.94 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 99.94 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.94 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 99.94 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 99.94 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 99.94 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 99.94 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 99.94 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 99.94 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 99.94 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 99.94 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 99.94 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 99.94 | |
| 2pmi_A | 317 | Negative RE, cyclin-dependent protein kinase PHO85 | 99.94 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 99.94 | |
| 1tki_A | 321 | Titin; serine kinase, muscle, autoinhibition; 2.00 | 99.94 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 99.93 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 99.93 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 99.93 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 99.93 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 99.93 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 99.93 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 99.93 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 99.93 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 99.93 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 99.93 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 99.93 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 99.93 | |
| 1ob3_A | 288 | PFPK5, cell division control protein 2 homolog; tr | 99.93 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 99.93 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 99.93 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 99.93 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 99.93 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 99.93 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 99.93 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 99.93 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 99.93 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 99.93 | |
| 4agu_A | 311 | Cyclin-dependent kinase-like 1; transferase, phosp | 99.93 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 99.93 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 99.93 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 99.93 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 99.93 | |
| 3mtl_A | 324 | Cell division protein kinase 16; pctaire1, indirub | 99.93 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 99.93 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 99.93 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 99.93 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 99.93 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 99.93 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 99.93 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 99.93 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 99.93 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 99.93 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 99.93 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 99.93 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 99.93 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 99.93 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 99.93 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 99.92 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 99.92 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 99.92 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 99.92 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 99.92 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 99.92 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 99.92 | |
| 3kk8_A | 284 | Calcium/calmodulin dependent protein kinase II; AT | 99.92 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 99.92 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 99.92 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 99.92 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 99.92 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 99.92 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 99.92 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 99.92 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 99.92 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 99.92 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 99.92 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 99.92 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 99.92 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 99.92 | |
| 2w5a_A | 279 | Serine/threonine-protein kinase NEK2; Ser/Thr prot | 99.92 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 99.92 | |
| 2wtk_C | 305 | Serine/threonine-protein kinase 11; transferase-me | 99.92 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 99.92 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 99.92 | |
| 3bhy_A | 283 | Death-associated protein kinase 3; death associate | 99.92 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 99.92 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 99.92 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 99.92 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.92 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 99.92 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 99.92 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 99.92 | |
| 2r3i_A | 299 | Cell division protein kinase 2; serine/threonine-p | 99.92 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 99.92 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 99.92 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 99.92 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 99.92 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 99.92 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 99.92 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 99.92 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 99.92 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 99.92 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 99.92 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 99.92 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 99.92 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 99.92 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 99.92 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 99.92 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 99.92 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 99.92 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 99.92 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 99.92 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 99.92 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 99.91 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.91 | |
| 3q4u_A | 301 | Activin receptor type-1; structural genomics conso | 99.91 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 99.91 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 99.91 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 99.91 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 99.91 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 99.91 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 99.91 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 99.91 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 99.91 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 99.91 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 99.91 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 99.91 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 99.91 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 99.91 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 99.91 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 99.91 | |
| 1zy4_A | 303 | Serine/threonine-protein kinase GCN2; translation | 99.91 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 99.91 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 99.91 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 99.91 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 99.91 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 99.91 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 99.91 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 99.91 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 99.91 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 99.91 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 99.91 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 99.91 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 99.91 | |
| 3dtc_A | 271 | Mitogen-activated protein kinase kinase kinase 9; | 99.91 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.91 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 99.91 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 99.91 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 99.91 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 99.91 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 99.91 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 99.91 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 99.91 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 99.91 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 99.91 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 99.91 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 99.91 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 99.91 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 99.91 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 99.91 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 99.91 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 99.91 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 99.91 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 99.9 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 99.9 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 99.9 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 99.9 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 99.9 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 99.9 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 99.9 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 99.9 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 99.9 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 99.9 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 99.9 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 99.9 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 99.9 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 99.9 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 99.9 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 99.9 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 99.9 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 99.9 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 99.9 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 99.9 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 99.9 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 99.9 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 99.9 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 99.9 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 99.9 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 99.9 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 99.9 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.9 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 99.9 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 99.9 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.89 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 99.89 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 99.89 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.89 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 99.89 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 99.89 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 99.89 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 99.89 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 99.89 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 99.89 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 99.89 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 99.89 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 99.89 | |
| 2eva_A | 307 | TAK1 kinase - TAB1 chimera fusion protein; transfe | 99.89 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.89 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 99.89 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.89 | |
| 3gxj_A | 303 | TGF-beta receptor type-1; ALK5, kinase, inhibitor, | 99.88 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 99.88 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 99.88 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 99.87 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.87 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 99.87 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.85 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 99.85 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 99.84 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 99.82 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 99.81 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 99.75 | |
| 3tm0_A | 263 | Aminoglycoside 3'-phosphotransferase; protein kina | 99.16 | |
| 1nd4_A | 264 | Aminoglycoside 3'-phosphotransferase; protein kina | 98.91 | |
| 3dxp_A | 359 | Putative acyl-COA dehydrogenase; protein kinase-li | 98.89 | |
| 3r70_A | 320 | Aminoglycoside phosphotransferase; structural geno | 98.24 | |
| 3sg8_A | 304 | APH(2'')-ID; antibiotic resistance enzyme, transfe | 98.06 | |
| 3tdw_A | 306 | Gentamicin resistance protein; kinase, phosphoryl | 98.02 | |
| 4gkh_A | 272 | Aminoglycoside 3'-phosphotransferase APHA1-IAB; py | 97.79 | |
| 3ovc_A | 362 | Hygromycin-B 4-O-kinase; aminoglycoside phosphotra | 97.76 | |
| 2olc_A | 397 | MTR kinase, methylthioribose kinase; kinase ADP-2H | 97.59 | |
| 2q83_A | 346 | YTAA protein; 2635576, structural genomics, joint | 97.47 | |
| 3ats_A | 357 | Putative uncharacterized protein; hypothetical pro | 97.44 | |
| 3d1u_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 97.19 | |
| 2pyw_A | 420 | Uncharacterized protein; 5-methylthioribose kinase | 95.79 | |
| 3dxq_A | 301 | Choline/ethanolamine kinase family protein; NP_106 | 95.69 | |
| 1nw1_A | 429 | Choline kinase (49.2 KD); phospholipid synthesis, | 95.66 | |
| 2ppq_A | 322 | HSK, HK, homoserine kinase; structural genomics, M | 95.42 | |
| 2qg7_A | 458 | Ethanolamine kinase PV091845; malaria, SGC, struct | 95.29 | |
| 3jr1_A | 312 | Putative fructosamine-3-kinase; YP_719053.1, struc | 95.16 | |
| 3f7w_A | 288 | Putative fructosamine-3-kinase; YP_290396.1, struc | 94.89 | |
| 3feg_A | 379 | Choline/ethanolamine kinase; non-protein kinase, c | 94.54 | |
| 1zyl_A | 328 | Hypothetical protein YIHE; putative protein kinase | 94.32 | |
| 3csv_A | 333 | Aminoglycoside phosphotransferase; YP_614837.1, ph | 93.76 | |
| 3i1a_A | 339 | Spectinomycin phosphotransferase; protein kinase, | 90.35 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 88.57 | |
| 3f2s_A | 401 | CK, chetk-alpha, choline kinase alpha; non-protein | 82.82 |
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-33 Score=242.39 Aligned_cols=128 Identities=30% Similarity=0.489 Sum_probs=108.6
Q ss_pred cccCeeeeEEeccCCceEEEEEEECCCCCEEEEEEeecc-------chhHHHHHHHHHHcCCCCeeecceeeeecccCCc
Q 024091 135 QTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQD-------KRYKNRELQIMRLLNHPNVVSLKHCFFSTTEKDE 207 (272)
Q Consensus 135 ~~~~y~~~~~lG~G~fg~V~~~~~~~~~~~vAvK~i~~~-------~~~~~~E~~~l~~l~h~nIv~l~~~~~~~~~~~~ 207 (272)
..++|++.+.||+|+||+||+|++..+|+.||||++.+. .....+|+++|+.|+|||||+++++| .+.
T Consensus 11 ~ig~Y~i~~~lG~G~fg~V~~~~~~~~~~~vAiK~i~~~~~~~~~~~~~~~~Ei~il~~l~HpnIv~~~~~~-----~~~ 85 (275)
T 3hyh_A 11 HIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVI-----KSK 85 (275)
T ss_dssp ---CCEEEEEEEC---CCEEEEECTTTCCEEEEEEEECC------CHHHHHHHHHHHHHCCCTTBCCEEEEE-----ECS
T ss_pred EeeCeEEEEEEecCcCeEEEEEEECCCCCEEEEEEEeHHHcCCHHHHHHHHHHHHHHHHCCCCCCCeEEEEE-----EEC
Confidence 346799999999999999999999999999999998542 22356899999999999999999998 344
Q ss_pred eEEEEEeecccccHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCCceecCCCCCCeeC
Q 024091 208 LYLNLVLEYISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272 (272)
Q Consensus 208 ~~~~lv~e~~~~~l~~~~~~~~~~~~~~~~~~~~~i~~qi~~~L~ylH~~~~iiHrDlKp~NILl 272 (272)
.++|||||||+|++++.+.. ...+++..++.|+.||+.||+|||+ ++||||||||+||||
T Consensus 86 ~~~~ivmEy~~g~L~~~l~~----~~~l~e~~~~~~~~qi~~al~ylH~-~~IiHRDiKP~NILl 145 (275)
T 3hyh_A 86 DEIIMVIEYAGNELFDYIVQ----RDKMSEQEARRFFQQIISAVEYCHR-HKIVHRDLKPENLLL 145 (275)
T ss_dssp SEEEEEEECCCEEHHHHHHH----SCSCCHHHHHHHHHHHHHHHHHHHH-TTCCCCCCCTTTEEE
T ss_pred CEEEEEEeCCCCCHHHHHHH----cCCCCHHHHHHHHHHHHHHHHHHHH-CCcccccCChHHeEE
Confidence 56999999999988876654 4579999999999999999999998 999999999999986
|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >3tm0_A Aminoglycoside 3'-phosphotransferase; protein kinase, phosphorylation, transferase-antibiotic COMP; HET: ANP B31; 2.10A {Enterococcus faecalis} SCOP: d.144.1.6 PDB: 2b0q_A* 1l8t_A* 3q2j_A* 1j7i_A* 1j7u_A* 3h8p_A* 1j7l_A* 2bkk_A* | Back alignment and structure |
|---|
| >1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3dxp_A Putative acyl-COA dehydrogenase; protein kinase-like fold, structural genomics, joint center structural genomics, JCSG; 2.32A {Ralstonia eutropha JMP134} | Back alignment and structure |
|---|
| >3sg8_A APH(2'')-ID; antibiotic resistance enzyme, transferase, aminoglycoside, phosphorylation, transferase-antibiotic complex; HET: TOY; 1.80A {Enterococcus casseliflavus} PDB: 3sg9_A* 3n4v_A 3n4t_A 3n4u_A 3r81_A* 3r80_A* 3r7z_A* 3r82_A* 3vcq_A* 4dbx_A 4de4_A* 4dfb_A* 4dfu_A* 4dt9_A* 4dt8_A* 4dtb_A* 3sgc_A 4dta_A* 3lzh_A | Back alignment and structure |
|---|
| >3tdw_A Gentamicin resistance protein; kinase, phosphoryl transfer, antibiotic resistance, transfer; HET: GDP; 1.70A {Enterococcus gallinarum} PDB: 3tdv_A* | Back alignment and structure |
|---|
| >4gkh_A Aminoglycoside 3'-phosphotransferase APHA1-IAB; pyrazolopyrimidine, 1-Na-PP1, bumped kinase inhibitor, BKI, kinase inhibitor; HET: KAN 0J9; 1.86A {Acinetobacter baumannii} PDB: 4feu_A* 4few_A* 4fex_A* 4fev_A* 4gki_A* 4ej7_A* 3r78_A* | Back alignment and structure |
|---|
| >2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* | Back alignment and structure |
|---|
| >2q83_A YTAA protein; 2635576, structural genomics, joint center for structu genomics, JCSG, protein structure initiative, PSI-2, transf; HET: ADN CIT UNL; 2.50A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3ats_A Putative uncharacterized protein; hypothetical protein, putative aminoglycoside phosphortransf transferase; 1.67A {Mycobacterium tuberculosis} PDB: 3att_A* | Back alignment and structure |
|---|
| >2pyw_A Uncharacterized protein; 5-methylthioribose kinase, plant methionine recycling, refol transferase; HET: SR1 ADP; 1.90A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dxq_A Choline/ethanolamine kinase family protein; NP_106042.1, STR genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 2.55A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1nw1_A Choline kinase (49.2 KD); phospholipid synthesis, protein kinase fold, transferase; 2.02A {Caenorhabditis elegans} SCOP: d.144.1.8 | Back alignment and structure |
|---|
| >2ppq_A HSK, HK, homoserine kinase; structural genomics, MCSG, PSI-2, protein structure initiative; 2.00A {Agrobacterium tumefaciens str} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >2qg7_A Ethanolamine kinase PV091845; malaria, SGC, structural genomics consortium, transferase; 2.41A {Plasmodium vivax} | Back alignment and structure |
|---|
| >3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} | Back alignment and structure |
|---|
| >3feg_A Choline/ethanolamine kinase; non-protein kinase, choline kinase, structural genomics CONS SGC, hemicholinium-3, phosphorylation; HET: HC7 ADP AMP; 1.30A {Homo sapiens} PDB: 3lq3_A* 2ig7_A* | Back alignment and structure |
|---|
| >1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 | Back alignment and structure |
|---|
| >3csv_A Aminoglycoside phosphotransferase; YP_614837.1, phosphotransferase enzyme family, structural genomics, JOIN for structural genomics, JCSG; HET: MSE; 2.15A {Silicibacter SP} | Back alignment and structure |
|---|
| >3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 272 | ||||
| d1q5ka_ | 350 | d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs | 1e-46 | |
| d1s9ja_ | 322 | d.144.1.7 (A:) Dual specificity mitogen-activated | 1e-31 | |
| d1koaa2 | 350 | d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C | 1e-29 | |
| d1nvra_ | 271 | d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { | 2e-29 | |
| d2ozaa1 | 335 | d.144.1.7 (A:51-385) MAP kinase activated protein | 5e-29 | |
| d2java1 | 269 | d.144.1.7 (A:3-271) Serine/threonine-protein kinas | 1e-28 | |
| d2jfla1 | 288 | d.144.1.7 (A:21-308) STE20-like serine/threonine-p | 1e-28 | |
| d1u5ra_ | 309 | d.144.1.7 (A:) Serine/threonine protein kinase TAO | 8e-28 | |
| d1yhwa1 | 293 | d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ | 2e-27 | |
| d1koba_ | 352 | d.144.1.7 (A:) Twitchin, kinase domain {California | 3e-27 | |
| d1pmea_ | 345 | d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien | 4e-27 | |
| d1uu3a_ | 288 | d.144.1.7 (A:) 3-phosphoinositide dependent protei | 6e-27 | |
| d1t4ha_ | 270 | d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa | 1e-26 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 5e-26 | |
| d1o6ya_ | 277 | d.144.1.7 (A:) Mycobacterial protein kinase PknB, | 5e-26 | |
| d2gfsa1 | 348 | d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa | 1e-25 | |
| d1cm8a_ | 346 | d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s | 2e-25 | |
| d2j4za1 | 263 | d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur | 4e-25 | |
| d1ckia_ | 299 | d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n | 4e-25 | |
| d1qpca_ | 272 | d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom | 6e-25 | |
| d3blha1 | 318 | d.144.1.7 (A:8-325) Cell division protein kinase 9 | 8e-25 | |
| d1tkia_ | 321 | d.144.1.7 (A:) Titin, kinase domain {Human (Homo s | 1e-24 | |
| d1blxa_ | 305 | d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H | 2e-24 | |
| d1q8ya_ | 362 | d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces | 2e-24 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 2e-24 | |
| d1byga_ | 262 | d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) | 3e-24 | |
| d1unla_ | 292 | d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H | 3e-24 | |
| d3bqca1 | 328 | d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu | 3e-24 | |
| d1a06a_ | 307 | d.144.1.7 (A:) Calmodulin-dependent protein kinase | 4e-24 | |
| d1ua2a_ | 299 | d.144.1.7 (A:) Cell division protein kinase 7, CDK | 5e-24 | |
| d1phka_ | 277 | d.144.1.7 (A:) gamma-subunit of glycogen phosphory | 1e-23 | |
| d1gz8a_ | 298 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H | 1e-23 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 3e-23 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 4e-23 | |
| d1u59a_ | 285 | d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum | 2e-22 | |
| d1jpaa_ | 299 | d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou | 3e-22 | |
| d2b1pa1 | 355 | d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 | 3e-22 | |
| d1csna_ | 293 | d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast | 4e-22 | |
| d1uwha_ | 276 | d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) | 5e-22 | |
| d1xwsa_ | 273 | d.144.1.7 (A:) Proto-oncogene serine/threonine-pro | 2e-21 | |
| d1t46a_ | 311 | d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens | 2e-21 | |
| d1ob3a_ | 286 | d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod | 4e-21 | |
| d1jksa_ | 293 | d.144.1.7 (A:) Death-associated protein kinase, Da | 4e-21 | |
| d1k2pa_ | 258 | d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum | 4e-21 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 5e-21 | |
| d1opja_ | 287 | d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou | 5e-21 | |
| d1rjba_ | 325 | d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s | 1e-20 | |
| d1sm2a_ | 263 | d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu | 1e-20 | |
| d1xkka_ | 317 | d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- | 2e-20 | |
| d1mp8a_ | 273 | d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma | 3e-20 | |
| d1fmka3 | 285 | d.144.1.7 (A:249-533) c-src tyrosine kinase {Human | 4e-20 | |
| d1xbba_ | 277 | d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human | 7e-20 | |
| d1mqba_ | 283 | d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum | 4e-19 | |
| d1u46a_ | 273 | d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum | 4e-19 | |
| d1vjya_ | 303 | d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human | 1e-18 | |
| d1r0pa_ | 311 | d.144.1.7 (A:) Hepatocyte growth factor receptor, | 5e-18 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 1e-17 | |
| d1fvra_ | 309 | d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ | 3e-17 | |
| d1fgka_ | 299 | d.144.1.7 (A:) Fibroblast growth factor receptor 1 | 1e-16 | |
| d1ywna1 | 299 | d.144.1.7 (A:818-1166) Vascular endothelial growth | 1e-16 | |
| d1lufa_ | 301 | d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n | 4e-16 | |
| d1p4oa_ | 308 | d.144.1.7 (A:) Insulin-like growth factor 1 recept | 4e-16 | |
| d1zara2 | 191 | d.144.1.9 (A:91-281) Rio2 serine protein kinase C- | 3e-12 |
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Glycogen synthase kinase-3 beta (Gsk3b) species: Human (Homo sapiens) [TaxId: 9606]
Score = 157 bits (397), Expect = 1e-46
Identities = 89/152 (58%), Positives = 120/152 (78%), Gaps = 3/152 (1%)
Query: 122 IATTVGGRNGQPKQTISYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNREL 181
+ T G +P Q +SY +V+G GSFGVV+QAK ++G+ VAIKKVLQDKR+KNREL
Sbjct: 6 VVATPGQGPDRP-QEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNREL 64
Query: 182 QIMRLLNHPNVVSLKHCFFSTTE-KDELYLNLVLEYISETVYRVSKHYTRMNQHVPILYV 240
QIMR L+H N+V L++ F+S+ E KDE+YLNLVL+Y+ ETVYRV++HY+R Q +P++YV
Sbjct: 65 QIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYV 124
Query: 241 QLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272
+LY YQ+ R+L Y+H G+CHRDIKPQNLL+
Sbjct: 125 KLYMYQLFRSLAYIHS-FGICHRDIKPQNLLL 155
|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 | Back information, alignment and structure |
|---|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Length = 191 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 272 | |||
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 100.0 | |
| d1nvra_ | 271 | Cell cycle checkpoint kinase chk1 {Human (Homo sap | 99.97 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 99.97 | |
| d2j4za1 | 263 | Aurora-related kinase 1 (aurora-2) {Human (Homo sa | 99.97 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 99.97 | |
| d2java1 | 269 | Serine/threonine-protein kinase Nek2 {Human (Homo | 99.97 | |
| d1tkia_ | 321 | Titin, kinase domain {Human (Homo sapiens) [TaxId: | 99.97 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 99.97 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 99.97 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 99.97 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 99.97 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 99.97 | |
| d1gz8a_ | 298 | Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T | 99.97 | |
| d1s9ja_ | 322 | Dual specificity mitogen-activated protein kinase | 99.97 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 99.97 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 99.97 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 99.97 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 99.97 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 99.97 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 99.97 | |
| d1phka_ | 277 | gamma-subunit of glycogen phosphorylase kinase (Ph | 99.97 | |
| d1ua2a_ | 299 | Cell division protein kinase 7, CDK7 {Human (Homo | 99.96 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 99.96 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 99.96 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1ob3a_ | 286 | Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) | 99.96 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 99.96 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 99.96 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 99.96 | |
| d1unla_ | 292 | Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T | 99.96 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 99.96 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 99.96 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 99.96 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 99.96 | |
| d1sm2a_ | 263 | Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie | 99.96 | |
| d1xwsa_ | 273 | Proto-oncogene serine/threonine-protein kinase Pim | 99.96 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 99.96 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 99.96 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 99.96 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 99.96 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1k2pa_ | 258 | Bruton's tyrosine kinase (Btk) {Human (Homo sapien | 99.95 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 99.95 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 99.95 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 99.95 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 99.95 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.95 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 99.95 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 99.95 | |
| d1byga_ | 262 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.95 | |
| d1csna_ | 293 | Casein kinase-1, CK1 {Fission yeast (Schizosacchar | 99.95 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 99.94 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 99.94 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 99.94 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 99.94 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 99.94 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 99.94 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 99.94 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 99.94 | |
| d1vjya_ | 303 | Type I TGF-beta receptor R4 {Human (Homo sapiens) | 99.93 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 99.93 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 99.91 | |
| d1zara2 | 191 | Rio2 serine protein kinase C-terminal domain {Arch | 99.87 | |
| d1j7la_ | 263 | Type IIIa 3',5"-aminoglycoside phosphotransferase | 97.52 | |
| d2pula1 | 392 | Methylthioribose kinase MtnK {Bacillus subtilis [T | 96.91 | |
| d1nd4a_ | 255 | Aminoglycoside 3'-phosphotransferase IIa (Kanamyci | 96.58 | |
| d1zyla1 | 325 | RdoA {Escherichia coli [TaxId: 562]} | 94.91 | |
| d1nw1a_ | 395 | Choline kinase {Caenorhabditis elegans [TaxId: 623 | 94.32 |
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: Glycogen synthase kinase-3 beta (Gsk3b) species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=7.9e-33 Score=243.61 Aligned_cols=134 Identities=63% Similarity=1.110 Sum_probs=121.4
Q ss_pred CeeeeEEeccCCceEEEEEEECCCCCEEEEEEeeccchhHHHHHHHHHHcCCCCeeecceeeeeccc-CCceEEEEEeec
Q 024091 138 SYMAERVVGTGSFGVVFQAKCLETGDSVAIKKVLQDKRYKNRELQIMRLLNHPNVVSLKHCFFSTTE-KDELYLNLVLEY 216 (272)
Q Consensus 138 ~y~~~~~lG~G~fg~V~~~~~~~~~~~vAvK~i~~~~~~~~~E~~~l~~l~h~nIv~l~~~~~~~~~-~~~~~~~lv~e~ 216 (272)
+|..+++||+|+||+||+|++..+|+.||||++..+.....+|+++|+.|+|||||+++++|+.... .+..|+||||||
T Consensus 21 ~Y~~~k~LG~G~fg~Vy~a~~~~~~~~vAiK~i~~~~~~~~~Ei~il~~l~h~niv~~~~~~~~~~~~~~~~~~~lv~Ey 100 (350)
T d1q5ka_ 21 SYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDY 100 (350)
T ss_dssp EEEEEEEEEEETTEEEEEEEETTTCCEEEEEEEECCSSSCCHHHHHHHHCCCTTBCCEEEEEEEC--CCSCCEEEEEEEC
T ss_pred CcEeeeEEeeCcCeEEEEEEECCCCCEEEEEEECccchHHHHHHHHHHhcCCCCCCcEEEEEEecCccCCceEEEEEEec
Confidence 6999999999999999999999999999999998877777789999999999999999999876543 456789999999
Q ss_pred ccccHHHHHHHhhhcCCCCCHHHHHHHHHHHHHHHHHHHhcCCceecCCCCCCeeC
Q 024091 217 ISETVYRVSKHYTRMNQHVPILYVQLYTYQICRALNYLHHVVGVCHRDIKPQNLLM 272 (272)
Q Consensus 217 ~~~~l~~~~~~~~~~~~~~~~~~~~~i~~qi~~~L~ylH~~~~iiHrDlKp~NILl 272 (272)
|+++++..+..+......+++..++.|+.||+.||+|||+ +|||||||||+||||
T Consensus 101 ~~~~~~~~l~~~~~~~~~l~~~~~~~i~~qil~aL~yLH~-~~IiHrDiKp~NILl 155 (350)
T d1q5ka_ 101 VPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHS-FGICHRDIKPQNLLL 155 (350)
T ss_dssp CSEEHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHHHHHHT-TTEECCCCCGGGEEE
T ss_pred cCCccHHHHHhhhhccCCCCHHHHHHHHHHHHHHHHHHHh-cCCcccCCCcceEEE
Confidence 9999888777766667789999999999999999999998 999999999999986
|
| >d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nw1a_ d.144.1.8 (A:) Choline kinase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|