Citrus Sinensis ID: 024118


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MKSIFSCFSFPSRVSAENTIGGEQILKNINAFSYNQLKIATNGFRWSNKIGEGGFGSVYKGRLQDGTIVAVKVLSVESKQGEKEFMSEVASMANVNVCHENLVKLHGGCIDGPCRILVYDYMPNNSLSQTLLGEEKRRAKFGWKARREIIMGIGRGLAYIHEEIQPHVVHRDIKTSNILLDQNFNPKISDFGLSKLFPENTTHISTRVAGTLGYLAPEYAISGRLTRKSDVYSFGVLLLEIVSGRTAVDFDVQLGEYHLVDKVRSINMKLYS
cccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccEEEECccccEEEEEEcccccccHHHHHHHHHHHHHHHHccccccccEEEEEEccccEEEEEEEcccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEcCEccccccccHHHHccccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHcc
***IFSCFSFP***************KNINAFSYNQLKIATNGFRWSNKIGEGGFGSVYKGRLQDGTIVAVKVLSVE******EFMSEVASMANVNVCHENLVKLHGGCIDGPCRILVYDYMPNNSLSQTLLGEEKRRAKFGWKARREIIMGIGRGLAYIHEEIQPHVVHRDIKTSNILLDQNFNPKISDFGLSKLFPENTTHISTRVAGTLGYLAPEYAISGRLTRKSDVYSFGVLLLEIVSGRTAVDFDVQLGEYHLVDKVRSINMKL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSIFSCFSFPSRVSAENTIGGEQILKNINAFSYNQLKIATNGFRWSNKIGEGGFGSVYKGRLQDGTIVAVKVLSVESKQGEKEFMSEVASMANVNVCHENLVKLHGGCIDGPCRILVYDYMPNNSLSQTLLGEEKRRAKFGWKARREIIMGIGRGLAYIHEEIQPHVVHRDIKTSNILLDQNFNPKISDFGLSKLFPENTTHISTRVAGTLGYLAPEYAISGRLTRKSDVYSFGVLLLEIVSGRTAVDFDVQLGEYHLVDKVRSINMKLYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative serine/threonine-protein kinase (Fragment) probableP85193

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2QKW, chain B
Confidence level:very confident
Coverage over the Query: 33-258
View the alignment between query and template
View the model in PyMOL
Template: 3TL8, chain A
Confidence level:confident
Coverage over the Query: 28-250
View the alignment between query and template
View the model in PyMOL