Citrus Sinensis ID: 024123


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MILNGYTTLSGCVPTNSNKCNVQQNRSVFASILGPPTHSAGLSTRSSWGTHHWVGSWSSGGFPVLHLSAASTPLLSGEQGSLAHTIPSLPMSRRSHLSPRASKDVPYSFRFPPMTKKPRWWWRSLACIPYLMPLHETWMYAETAYHLHPFLEDFEYLTYPFLEAIGKLPVWFLMAYFFVAYLGVVRRKEWPHFFRFHVVMGMLLEIALQVVGTASTWLPYGIYWGKLGMHFWTAVAFGFLFTVLECIRCALRGMYADLPFFCDAACIQIPYE
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHECccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHccccc
****GYTTLSGCVPTNSNKCNVQQNRSVFASILGP*****GLSTRSSWGTHHWVGSWSSGGFPVLHLSAA*************************************SFRFPPMTKKPRWWWRSLACIPYLMPLHETWMYAETAYHLHPFLEDFEYLTYPFLEAIGKLPVWFLMAYFFVAYLGVVRRKEWPHFFRFHVVMGMLLEIALQVVGTASTWLPYGIYWGKLGMHFWTAVAFGFLFTVLECIRCALRGMYADLPFFCDAACIQIP**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MILNGYTTLSGCVPTNSNKCNVQQNRSVFASILGPPTHSAGLSTRSSWGTHHWVGSWSSGGFPVLHLSAASTPLLSGEQGSLAHTIPSLPMSRRSHLSPRASKDVPYSFRFPPMTKKPRWWWRSLACIPYLMPLHETWMYAETAYHLHPFLEDFEYLTYPFLEAIGKLPVWFLMAYFFVAYLGVVRRKEWPHFFRFHVVMGMLLEIALQVVGTASTWLPYGIYWGKLGMHFWTAVAFGFLFTVLECIRCALRGMYADLPFFCDAACIQIPYE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein TIC 20-I, chloroplastic Involved in protein precursor import into chloroplasts. May be part of an intermediate translocation complex acting as a protein-conducting channel at the inner envelope. Seems to be specific for photosynthesis-related pre-proteins. Partially redundant with TIC20-IV, but not with TIC20-II or TIC20-V.probableQ8GZ79
Protein TIC 20, chloroplastic Involved in protein precursor import into chloroplasts. May be part of an intermediate translocation complex acting as a protein-conducting channel at the inner envelope. Seems to be specific for photosynthesis-related pre-proteins.probableQ9ZST8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted