BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024138
         (272 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HK0|A Chain A, Crystal Structure Of The Ra And Ph Domains Of Grb10
 pdb|3HK0|B Chain B, Crystal Structure Of The Ra And Ph Domains Of Grb10
          Length = 256

 Score = 30.4 bits (67), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 109 FKTDYNQTHFVRN------KEFKEAADKMQGPLRQIFVEFLERSCTAEFSGFLLYKELGR 162
           F+ +Y +  F +N      ++    + +  G   Q+   FL  S + E  GFL  KELG+
Sbjct: 86  FRKNYAKYEFFKNPMNFFPEQMVTWSQQSNGSQTQLLQNFLNSSSSPEIQGFLHVKELGK 145

Query: 163 R 163
           +
Sbjct: 146 K 146


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.322    0.132    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,413,596
Number of Sequences: 62578
Number of extensions: 223484
Number of successful extensions: 494
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 493
Number of HSP's gapped (non-prelim): 3
length of query: 272
length of database: 14,973,337
effective HSP length: 97
effective length of query: 175
effective length of database: 8,903,271
effective search space: 1558072425
effective search space used: 1558072425
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 51 (24.3 bits)