Citrus Sinensis ID: 024141


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--
MYQRLDMITPGVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVGNVYVQFREEEQAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDLRRQLFGRYRRRHSRSRSRSRSPYRHRSHEDRSHSGHGRRYDDRDKYYESRSRRHRSTSPSHRRGRSRSPGGRRYHSPVREGSEERRAKIEQWNREREQQEEAYKGNTDGGNNDQGINNDGLMQNGNGYHSYKQQPEQGGNEY
ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccEEEEEccHHHHHHHHHHHcccccccccEEEEEccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
MYQR***ITPG***Q*NPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVGNVYVQFREEEQAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDLRRQLFGR***************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYQRLDMITPGVDAQGNPLDPRKIQEHFEDFYEDLFEELNKYGEIESLNICDNLADHMVGNVYVQFREEEQAARALKSLSGRFYAGRPIIVDFSPVTDFREATCRQYEENTCNRGGYCNFMHLKRISRDLRRQLFGRYRRRHSRSRSRSRSPYRHRSHEDRSHSGHGRRYDDRDKYYESRSRRHRSTSPSHRRGRSRSPGGRRYHSPVREGxxxxxxxxxxxxxxxxxxxxxYKGNTDGGNNDQGINNDGLMQNGNGYHSYKQQPEQGGNEY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Splicing factor U2af small subunit B Necessary for the splicing of pre-mRNA.probableQ6AUG0
Splicing factor U2af small subunit B Necessary for the splicing of pre-mRNA.probableQ9FMY5
Splicing factor U2af small subunit A Necessary for the splicing of pre-mRNA.probableQ9ZQW8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 28-97
View the alignment between query and template
View the model in PyMOL
Template: 1JMT, chain A
Confidence level:very confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL