Citrus Sinensis ID: 024163

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-

MLPRSLALPSPLLLSSFRSGASAEGVPKRLTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVKAESVNKNAPPDFQNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRGDEEDLAKENIKNTSSSTGKITLSVTKSKPETGEVIGVFESLQPSDTDMGAKVPKDVKIQGIWYAQLEQ

ccHHHHHHHHHHHHHHcccccccccccccccHHHHccEEEEEECcCECccccccccccccccECccccccccccEEcccEEEEEECcccccccccccccCEEEEEEEEcccCEEEEEEcccccEEEEECcccEEEEEEEEcccccCEEEEEEEEcHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccEEEEEEEEEEccccccEEEEEEEEccccccccccccccEEEEEEEEEEEcc

*LPRSLALPSPLLLSSFRSGAS*******LTYDEIQSKTYMEVKGTGTANQCPTIDGGVDSFAFKPGKYQAKKFCLEPTSFTVK************QNTKLMTRLTYTLDEIEGPFEVSPDGTIKFVEKDGIDYAAVTVQLPGGERVPFLFTIKQLVASGKPENFGGEFLVPSYRGSSFLDPKGRGGSTGYDNAIALPAGGRG*******ENIKNTSSSTGKITLSVTKSKPETGEVIGVFES*Q*******AKVPKDVKIQGIWYAQLE*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Photosystem II manganese-stabilizing polypeptide	MSP binds to a putative Mn-binding protein and keeps 2 of the 4 Mn-atoms associated with PSII.	probable	P13907
Oxygen-evolving enhancer protein 1, chloroplastic	Stabilizes the manganese cluster which is the primary site of water splitting.	probable	Q40459
Oxygen-evolving enhancer protein 1-1, chloroplastic	Stabilizes the manganese cluster which is the primary site of water splitting.	probable	P23321

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ARC, chain O
Confidence level:very confident
Coverage over the Query: 37-271
View the alignment between query and template
View the model in PyMOL