Citrus Sinensis ID: 024167
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| 356505250 | 329 | PREDICTED: uncharacterized protein LOC10 | 0.915 | 0.753 | 0.488 | 9e-57 | |
| 356570770 | 335 | PREDICTED: uncharacterized protein LOC10 | 0.937 | 0.758 | 0.495 | 2e-54 | |
| 224140221 | 330 | predicted protein [Populus trichocarpa] | 0.966 | 0.793 | 0.531 | 1e-53 | |
| 413968366 | 324 | hypothetical protein [Phaseolus vulgaris | 0.911 | 0.762 | 0.455 | 1e-52 | |
| 255556920 | 345 | metal ion binding protein, putative [Ric | 0.929 | 0.730 | 0.5 | 2e-52 | |
| 18404283 | 386 | heavy-metal-associated domain-containing | 0.974 | 0.683 | 0.479 | 2e-50 | |
| 449451042 | 324 | PREDICTED: uncharacterized protein LOC10 | 0.959 | 0.802 | 0.437 | 2e-49 | |
| 388495726 | 343 | unknown [Lotus japonicus] | 0.952 | 0.752 | 0.477 | 3e-49 | |
| 297823503 | 388 | hypothetical protein ARALYDRAFT_482676 [ | 0.970 | 0.677 | 0.469 | 1e-48 | |
| 356548272 | 331 | PREDICTED: uncharacterized protein LOC54 | 0.966 | 0.791 | 0.513 | 7e-48 |
| >gi|356505250|ref|XP_003521405.1| PREDICTED: uncharacterized protein LOC100792662 [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 226 bits (575), Expect = 9e-57, Method: Compositional matrix adjust.
Identities = 149/305 (48%), Positives = 186/305 (60%), Gaps = 57/305 (18%)
Query: 1 MKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKS 60
+++++GV DVKTD + K+TV GKV+PAK++++L KTKKKV+L+SPQPKKD+ G +
Sbjct: 48 VRHFDGVEDVKTDLSSKKLTVIGKVDPAKVRDKLAEKTKKKVELISPQPKKDSAGDKPPE 107
Query: 61 EEKSEKKPDDKKSEEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDL 120
E+KSE+K + K E+K PKESTVVLKIRLHCEGCI KI+KII KTKGV++V I+GGKDL
Sbjct: 108 EKKSEEKKPEDKKAEEKTPKESTVVLKIRLHCEGCIQKIRKIILKTKGVESVNIEGGKDL 167
Query: 121 VTVKGTMDVKELVPYLKEKLKRNVEVVPAKKDDGEKKENKDADKGGDKKAKEAAPATDKG 180
V+VKGTMDVKE+VPYL EKLKRNVEVVP KK+ G DK
Sbjct: 168 VSVKGTMDVKEIVPYLNEKLKRNVEVVPPKKEGG-----------------------DKK 204
Query: 181 GEKKEKEAAAAGGGDGGKVEVHKMEYYGYPYPPAPSYWYDNHVYG------------QSY 228
K++ G KVEV+KME+YGY YP YW+ + Y SY
Sbjct: 205 ENNKKEGGGGGGAEGAAKVEVNKMEHYGYAYPAPHMYWHGHGGYAPGESSSSSSSSNNSY 264
Query: 229 PMENQHQVVYANQGY----------------------PPQMHHAPPMYHAPQMFSDENPN 266
+E Q Y+NQGY PP + P + PQMFSDENPN
Sbjct: 265 EVEVQSGYSYSNQGYDGNYVNYPYQHGYNDNYMAMAQPPPPFYLNPHHPPPQMFSDENPN 324
Query: 267 ACSVM 271
ACSVM
Sbjct: 325 ACSVM 329
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|356570770|ref|XP_003553557.1| PREDICTED: uncharacterized protein LOC100795652 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224140221|ref|XP_002323483.1| predicted protein [Populus trichocarpa] gi|222868113|gb|EEF05244.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|413968366|gb|AFW90521.1| hypothetical protein [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|255556920|ref|XP_002519493.1| metal ion binding protein, putative [Ricinus communis] gi|223541356|gb|EEF42907.1| metal ion binding protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|18404283|ref|NP_565855.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] gi|20197942|gb|AAD31580.2| putative farnesylated protein [Arabidopsis thaliana] gi|330254231|gb|AEC09325.1| heavy-metal-associated domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|449451042|ref|XP_004143271.1| PREDICTED: uncharacterized protein LOC101221463 isoform 2 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|388495726|gb|AFK35929.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297823503|ref|XP_002879634.1| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata] gi|297325473|gb|EFH55893.1| hypothetical protein ARALYDRAFT_482676 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356548272|ref|XP_003542527.1| PREDICTED: uncharacterized protein LOC547884 [Glycine max] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 271 | ||||||
| TAIR|locus:2057951 | 386 | AT2G36950 [Arabidopsis thalian | 0.546 | 0.383 | 0.450 | 2.2e-38 | |
| TAIR|locus:2142614 | 392 | AT5G03380 [Arabidopsis thalian | 0.247 | 0.170 | 0.611 | 6.2e-34 | |
| TAIR|locus:2163300 | 290 | AT5G50740 [Arabidopsis thalian | 0.180 | 0.168 | 0.48 | 7.7e-23 | |
| TAIR|locus:2167366 | 355 | FP3 "farnesylated protein 3" [ | 0.180 | 0.138 | 0.48 | 1.9e-21 | |
| TAIR|locus:2046183 | 245 | AT2G28090 [Arabidopsis thalian | 0.505 | 0.559 | 0.351 | 1.4e-20 | |
| TAIR|locus:2075497 | 246 | AT3G02960 "AT3G02960" [Arabido | 0.239 | 0.264 | 0.338 | 4.2e-19 | |
| TAIR|locus:2018768 | 287 | AT1G29000 [Arabidopsis thalian | 0.516 | 0.487 | 0.256 | 7e-19 | |
| TAIR|locus:2153969 | 319 | AT5G24580 "AT5G24580" [Arabido | 0.247 | 0.210 | 0.298 | 8.1e-14 | |
| TAIR|locus:2096204 | 577 | AT3G05220 [Arabidopsis thalian | 0.173 | 0.081 | 0.407 | 1.6e-06 | |
| TAIR|locus:2133544 | 150 | AT4G08570 "AT4G08570" [Arabido | 0.239 | 0.433 | 0.343 | 2.1e-06 |
| TAIR|locus:2057951 AT2G36950 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 303 (111.7 bits), Expect = 2.2e-38, Sum P(2) = 2.2e-38
Identities = 68/151 (45%), Positives = 84/151 (55%)
Query: 1 MKNYEGVVDVKTDCGANKVTVTGKVEPAKLKERLEAKTKKKVDLVSPQPXXXXXXXXXXX 60
+K+++GV DV D G NK+ V GK++P KL+E+LE KTK+KV L +P P
Sbjct: 71 VKHFDGVKDVTADTGGNKLLVVGKIDPVKLQEKLEEKTKRKVVLANPPPKVEGPVAAAVG 130
Query: 61 XXXXXXXXXXXX--XXXXXXXXXSTVVLKIRLHCEGCXXXXXXXXXXXXGVDNVTIDGGK 118
S V LKIRLHCEGC GV+ V IDG K
Sbjct: 131 EKKADGGDKEAAPPAPAPAAPKESVVPLKIRLHCEGCIQKIKKIILKIKGVETVAIDGAK 190
Query: 119 DLVTVKGTMDVKELVPYLKEKLKRNVE-VVP 148
D+VTVKGT+DVKELVP L +KLKR VE +VP
Sbjct: 191 DVVTVKGTIDVKELVPLLTKKLKRTVEPLVP 221
|
|
| TAIR|locus:2142614 AT5G03380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2163300 AT5G50740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2167366 FP3 "farnesylated protein 3" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2046183 AT2G28090 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2075497 AT3G02960 "AT3G02960" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2018768 AT1G29000 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2153969 AT5G24580 "AT5G24580" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2096204 AT3G05220 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133544 AT4G08570 "AT4G08570" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| grail3.0004046801 | hypothetical protein (330 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| pfam00403 | 62 | pfam00403, HMA, Heavy-metal-associated domain | 5e-08 | |
| cd00371 | 63 | cd00371, HMA, Heavy-metal-associated domain (HMA) | 0.002 |
| >gnl|CDD|215902 pfam00403, HMA, Heavy-metal-associated domain | Back alignment and domain information |
|---|
Score = 48.4 bits (116), Expect = 5e-08
Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 5/62 (8%)
Query: 84 VVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRN 143
+ + C GC K++K + K GV +V++D VTV G D +L EKLK+
Sbjct: 1 TLRVPGMTCAGCAKKVEKALSKLPGVSSVSVDLETGKVTVTGDPDPLKL-----EKLKKA 55
Query: 144 VE 145
+E
Sbjct: 56 IE 57
|
Length = 62 |
| >gnl|CDD|238219 cd00371, HMA, Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 99.42 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 99.33 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 99.28 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 98.9 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.65 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 98.61 | |
| KOG0207 | 951 | consensus Cation transport ATPase [Inorganic ion t | 98.48 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 98.43 | |
| PRK10671 | 834 | copA copper exporting ATPase; Provisional | 98.29 | |
| COG2217 | 713 | ZntA Cation transport ATPase [Inorganic ion transp | 98.05 | |
| TIGR00003 | 68 | copper ion binding protein. This model describes a | 97.76 | |
| PF00403 | 62 | HMA: Heavy-metal-associated domain; InterPro: IPR0 | 97.26 | |
| KOG1603 | 73 | consensus Copper chaperone [Inorganic ion transpor | 96.82 | |
| PRK11033 | 741 | zntA zinc/cadmium/mercury/lead-transporting ATPase | 96.58 | |
| COG2608 | 71 | CopZ Copper chaperone [Inorganic ion transport and | 95.63 | |
| TIGR02052 | 92 | MerP mercuric transport protein periplasmic compon | 93.56 | |
| cd00371 | 63 | HMA Heavy-metal-associated domain (HMA) is a conse | 89.64 | |
| PRK13748 | 561 | putative mercuric reductase; Provisional | 86.92 | |
| KOG4656 | 247 | consensus Copper chaperone for superoxide dismutas | 83.76 | |
| PLN02957 | 238 | copper, zinc superoxide dismutase | 82.37 |
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
Probab=99.42 E-value=5.9e-13 Score=95.27 Aligned_cols=58 Identities=28% Similarity=0.513 Sum_probs=53.8
Q ss_pred EEEe-eccchhhHHHHHHHhhcCCCccEEEEecCCCEEEEEec---CCHHHHHHHHHhhcCCc
Q 024167 85 VLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGT---MDVKELVPYLKEKLKRN 143 (271)
Q Consensus 85 ~l~V-gM~C~~Ca~kIekaL~ki~GV~~v~Vd~~~~~VtV~g~---~d~~~L~~~l~kk~G~~ 143 (271)
+|+| +|+|++|+++|+++|.+++||.++.+|+.+++|+|.+. +++.+|+++|+ ++||+
T Consensus 1 t~~v~~m~C~~C~~~v~~~l~~~~GV~~v~vd~~~~~v~v~~~~~~~~~~~i~~~i~-~~Gy~ 62 (62)
T PF00403_consen 1 TFKVPGMTCEGCAKKVEKALSKLPGVKSVKVDLETKTVTVTYDPDKTSIEKIIEAIE-KAGYE 62 (62)
T ss_dssp EEEEESTTSHHHHHHHHHHHHTSTTEEEEEEETTTTEEEEEESTTTSCHHHHHHHHH-HTTSE
T ss_pred CEEECCcccHHHHHHHHHHHhcCCCCcEEEEECCCCEEEEEEecCCCCHHHHHHHHH-HhCcC
Confidence 5888 99999999999999999999999999999999999976 45699999999 89984
|
These proteins provide an important focus for research, some being involved in bacterial resistance to toxic metals, such as lead and cadmium, while others are involved in inherited human syndromes, such as Wilson's and Menke's diseases []. A conserved domain has been found in a number of these heavy metal transport or detoxification proteins []. The domain, which has been termed Heavy-Metal-Associated (HMA), contains two conserved cysteines that are probably involved in metal binding. Structure solution of the fourth HMA domain of the Menke's copper transporting ATPase shows a well-defined structure comprising a four-stranded antiparallel beta-sheet and two alpha helices packed in an alpha-beta sandwich fold []. This fold is common to other domains and is classified as "ferredoxin-like".; GO: 0046872 metal ion binding, 0030001 metal ion transport; PDB: 2VOY_A 1P6T_A 1KQK_A 2RML_A 1JWW_A 3K7R_F 1FES_A 1CC8_A 1FD8_A 2GGP_A .... |
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
| >PRK10671 copA copper exporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00003 copper ion binding protein | Back alignment and domain information |
|---|
| >PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures | Back alignment and domain information |
|---|
| >KOG1603 consensus Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional | Back alignment and domain information |
|---|
| >COG2608 CopZ Copper chaperone [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02052 MerP mercuric transport protein periplasmic component | Back alignment and domain information |
|---|
| >cd00371 HMA Heavy-metal-associated domain (HMA) is a conserved domain of approximately 30 amino acid residues found in a number of proteins that transport or detoxify heavy metals, for example, the CPx-type heavy metal ATPases and copper chaperones | Back alignment and domain information |
|---|
| >PRK13748 putative mercuric reductase; Provisional | Back alignment and domain information |
|---|
| >KOG4656 consensus Copper chaperone for superoxide dismutase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02957 copper, zinc superoxide dismutase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 271 | |||
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 8e-11 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 1e-04 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 5e-09 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 5e-08 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 9e-07 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 3e-06 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 1e-04 |
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
Score = 56.8 bits (137), Expect = 8e-11
Identities = 13/66 (19%), Positives = 30/66 (45%)
Query: 73 SEEKKPPKESTVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKEL 132
S+ T+ +++ C+ C+ ++K + GV +V + +V V T+ +E+
Sbjct: 10 SDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEV 69
Query: 133 VPYLKE 138
L+
Sbjct: 70 QALLEG 75
|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 222 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 Length = 249 | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A Length = 68 | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A Length = 73 | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} Length = 202 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 99.59 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 99.57 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 99.56 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 99.46 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 99.45 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 99.42 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 99.4 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 99.39 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 99.32 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 99.29 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 99.29 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 99.23 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 99.21 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 99.2 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 99.2 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 99.2 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 99.2 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 99.18 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 99.18 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 99.16 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 99.16 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 99.16 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 99.16 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 99.15 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 99.14 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 99.13 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 99.13 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 99.11 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 99.09 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 99.09 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 99.08 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 99.06 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 99.05 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 99.03 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 99.02 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 98.92 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 98.9 | |
| 2ew9_A | 149 | Copper-transporting ATPase 2; copper trafficking, | 98.83 | |
| 2rop_A | 202 | Copper-transporting ATPase 2; wilson protein, mobi | 98.59 | |
| 1p6t_A | 151 | Potential copper-transporting ATPase; COPA, P-type | 98.51 | |
| 3j09_A | 723 | COPA, copper-exporting P-type ATPase A; copper tra | 98.41 | |
| 3iwl_A | 68 | Copper transport protein ATOX1; beta-alpha-beta-BE | 97.56 | |
| 1cc8_A | 73 | Protein (metallochaperone ATX1); copper transport, | 97.25 | |
| 2crl_A | 98 | Copper chaperone for superoxide dismutase; SOD1, f | 97.11 | |
| 4a4j_A | 69 | Pacszia, cation-transporting ATPase PACS; hydrolas | 97.04 | |
| 3dxs_X | 74 | Copper-transporting ATPase RAN1; CXXC motif, ferre | 96.93 | |
| 3fry_A | 73 | Probable copper-exporting P-type ATPase A; transpo | 96.68 | |
| 2xmm_A | 64 | SSR2857 protein, ATX1; metal transport, copper hom | 96.53 | |
| 2ofg_X | 111 | Zinc-transporting ATPase; ferredoxin-like fold, be | 96.51 | |
| 2roe_A | 66 | Heavy metal binding protein; NMR {Thermus thermoph | 96.33 | |
| 2k2p_A | 85 | Uncharacterized protein ATU1203; putative metal-bi | 96.16 | |
| 1cpz_A | 68 | Protein (COPZ); copper chaperone, metal transport, | 96.08 | |
| 2g9o_A | 90 | Copper-transporting ATPase 1; menkes disease, solu | 96.03 | |
| 2xmw_A | 71 | PACS-N, cation-transporting ATPase PACS; hydrolase | 95.91 | |
| 1aw0_A | 72 | Menkes copper-transporting ATPase; copper-binding | 95.87 | |
| 1osd_A | 72 | MERP, hypothetical protein MERP; mercury resistanc | 95.87 | |
| 2l3m_A | 71 | Copper-ION-binding protein; structural genomics, c | 95.84 | |
| 2kt2_A | 69 | Mercuric reductase; nmera, MERA, HMA domain, mercu | 95.81 | |
| 1yg0_A | 66 | COP associated protein; open-faced beta-sandwich, | 95.73 | |
| 1q8l_A | 84 | Copper-transporting ATPase 1; metal binding protei | 95.46 | |
| 3cjk_B | 75 | Copper-transporting ATPase 1; HAH1, ATP7B, menkes | 95.43 | |
| 1yjr_A | 75 | Copper-transporting ATPase 1; metallochaperone, pr | 95.42 | |
| 1qup_A | 222 | Superoxide dismutase 1 copper chaperone; two domai | 95.4 | |
| 2qif_A | 69 | Copper chaperone COPZ; tetranuclear Cu(I) cluster; | 95.39 | |
| 1kvi_A | 79 | Copper-transporting ATPase 1; menkes, Cu-protein, | 95.28 | |
| 1fvq_A | 72 | Copper-transporting ATPase; APO-CCC2A, hydrolase; | 95.23 | |
| 1y3j_A | 77 | Copper-transporting ATPase 1; ferrodoxin-like fold | 95.05 | |
| 2ldi_A | 71 | Zinc-transporting ATPase; metal homeostasis, metal | 95.02 | |
| 1mwy_A | 73 | ZNTA; open-faced beta-sandwich fold, beta-alpha-be | 94.93 | |
| 1opz_A | 76 | Potential copper-transporting ATPase; mutation, fo | 94.86 | |
| 2kyz_A | 67 | Heavy metal binding protein; structural genomics, | 94.81 | |
| 1jk9_B | 249 | CCS, copper chaperone for superoxide dismutase; pr | 94.59 | |
| 1jww_A | 80 | Potential copper-transporting ATPase; beta-alpha-b | 93.67 | |
| 2kkh_A | 95 | Putative heavy metal transporter; zinc transport, | 93.1 | |
| 2aj0_A | 71 | Probable cadmium-transporting ATPase; ferrodoxin-l | 91.37 |
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.59 E-value=1.2e-14 Score=116.83 Aligned_cols=116 Identities=13% Similarity=0.309 Sum_probs=94.8
Q ss_pred CCCCCCceEEEEeccCcEEEEEee---cChHHHHHHHHHhhcccccccCCCCCCCCCCCCCcccccccCCCCCccccccC
Q 024167 1 MKNYEGVVDVKTDCGANKVTVTGK---VEPAKLKERLEAKTKKKVDLVSPQPKKDAGGGEKKSEEKSEKKPDDKKSEEKK 77 (271)
Q Consensus 1 L~kl~GV~sv~Vn~a~~kltV~g~---vd~~~lv~~I~~k~Gy~aelvs~~p~~~~~~~~~~~~~~~~~k~~~~~~~~~~ 77 (271)
|..++||.++.+|+.+.+++|.+. .++..|...|+ .+||.+.++...
T Consensus 26 l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~G~~~~~~~~~----------------------------- 75 (149)
T 2ew9_A 26 LQKEAGVLSVLVALMAGKAEIKYDPEVIQPLEIAQFIQ-DLGFEAAVMEDY----------------------------- 75 (149)
T ss_dssp HHTTSSCCCEEEETTTTEEEEEECTTTCCHHHHHHHHH-HHTCEEEECSCS-----------------------------
T ss_pred HhcCCCcEEEEEEecCCEEEEEEcCCCCCHHHHHHHHh-cCCCceEeeccc-----------------------------
Confidence 356899999999999999999873 35567888888 689976533210
Q ss_pred CCCceeEEEEe-eccchhhHHHHHHHhhcCCCccEEEEecCCCEEEEEec---CCHHHHHHHHHhhcCCceEEc
Q 024167 78 PPKESTVVLKI-RLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGT---MDVKELVPYLKEKLKRNVEVV 147 (271)
Q Consensus 78 ~~~~~~v~l~V-gM~C~~Ca~kIekaL~ki~GV~~v~Vd~~~~~VtV~g~---~d~~~L~~~l~kk~G~~ae~v 147 (271)
.....++.|.| ||+|.+|+.+|+++|.+++||.++.||+.+++++|... +++..|++.|. ++||.+.++
T Consensus 76 ~~~~~~~~~~v~gm~C~~C~~~ie~~l~~~~gv~~~~v~~~~~~~~v~~~~~~~~~~~i~~~i~-~~Gy~~~~~ 148 (149)
T 2ew9_A 76 AGSDGNIELTITGMTCASCVHNIESKLTRTNGITYASVALATSKALVKFDPEIIGPRDIIKIIE-EIGFHASLA 148 (149)
T ss_dssp CCSSSEEEEEEESCCSHHHHHHHHHHHHHSSSCCEEEEETTTTEEEEECCTTTSCHHHHHHHHH-HHTCEEECC
T ss_pred ccccceeEEEEEeccCHHHHHHHHHHHhcCCCeEEEEEEcCCCEEEEEECCCCCCHHHHHHHHH-hCCCceEec
Confidence 00123578999 99999999999999999999999999999999999843 57899999999 999988754
|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
| >2ew9_A Copper-transporting ATPase 2; copper trafficking, ferrodoxin-like fold, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rop_A Copper-transporting ATPase 2; wilson protein, mobility, protein-protein interaction, alternative splicing, ATP-binding, copper transport cytoplasm; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1p6t_A Potential copper-transporting ATPase; COPA, P-type ATPase, water-soluble region, beta-alpha-beta- beta-alpha-beta fold; NMR {Bacillus subtilis} SCOP: d.58.17.1 d.58.17.1 PDB: 2rml_A | Back alignment and structure |
|---|
| >3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3iwl_A Copper transport protein ATOX1; beta-alpha-beta-BETA-alpha-beta, cisplatin, platinum, chaperone, ION transport, metal-binding, metal transport; HET: TCE; 1.60A {Homo sapiens} SCOP: d.58.17.1 PDB: 1fe4_A* 1fee_A* 1tl4_A 1tl5_A 2k1r_B 1fe0_A* 3iwx_A 3cjk_A | Back alignment and structure |
|---|
| >1cc8_A Protein (metallochaperone ATX1); copper transport, mercury coordination, metal transport; 1.02A {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1cc7_A 1fd8_A 1fes_A 2ggp_A 3k7r_A | Back alignment and structure |
|---|
| >2crl_A Copper chaperone for superoxide dismutase; SOD1, familial ALS, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4a4j_A Pacszia, cation-transporting ATPase PACS; hydrolase, copper homeostasis, zinc homeostasis, ATX1, metal-transporting atpases; 1.25A {Synechocystis} PDB: 4a48_A 2gcf_A 2xmw_A | Back alignment and structure |
|---|
| >3dxs_X Copper-transporting ATPase RAN1; CXXC motif, ferredoxin-like fold, ATP- binding, ethylene signaling pathway, hydrolase, ION transport; 1.70A {Arabidopsis thaliana} SCOP: d.58.17.0 | Back alignment and structure |
|---|
| >3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2xmm_A SSR2857 protein, ATX1; metal transport, copper homeostasis, chaperone, P-type atpas; 1.65A {Synechocystis SP} PDB: 2xmv_A 1sb6_A 2xmj_A 2xmk_A 2xmt_A 2xmu_A | Back alignment and structure |
|---|
| >2roe_A Heavy metal binding protein; NMR {Thermus thermophilus} PDB: 2rog_A | Back alignment and structure |
|---|
| >2k2p_A Uncharacterized protein ATU1203; putative metal-binding domain ATU1203, ontario centre for ST proteomics, structural genomics; NMR {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >1cpz_A Protein (COPZ); copper chaperone, metal transport, gene regulation; NMR {Enterococcus hirae} SCOP: d.58.17.1 | Back alignment and structure |
|---|
| >2g9o_A Copper-transporting ATPase 1; menkes disease, solution structure, structural genomics, structural proteomics in europe, spine, hydrolase; NMR {Homo sapiens} PDB: 2ga7_A | Back alignment and structure |
|---|
| >2xmw_A PACS-N, cation-transporting ATPase PACS; hydrolase, Cu(I)-binding, trafficking; 1.80A {Synechocystis SP} PDB: 2gcf_A | Back alignment and structure |
|---|
| >1aw0_A Menkes copper-transporting ATPase; copper-binding domain, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 2aw0_A | Back alignment and structure |
|---|
| >1osd_A MERP, hypothetical protein MERP; mercury resistance, metal binding protein, perisplasm, structural genomics; 2.00A {Cupriavidus metallidurans} SCOP: d.58.17.1 PDB: 1afi_A 1afj_A 2hqi_A | Back alignment and structure |
|---|
| >2l3m_A Copper-ION-binding protein; structural genomics, center for structural genomics of infec diseases, csgid, metal binding protein; NMR {Bacillus anthracis} | Back alignment and structure |
|---|
| >2kt2_A Mercuric reductase; nmera, MERA, HMA domain, mercuric resist metal-binding, oxidoreductase; NMR {Pseudomonas aeruginosa} PDB: 2kt3_A | Back alignment and structure |
|---|
| >1yg0_A COP associated protein; open-faced beta-sandwich, missing C-terminal beta-sheet, Met transport; NMR {Helicobacter pylori} | Back alignment and structure |
|---|
| >1q8l_A Copper-transporting ATPase 1; metal binding protein; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1s6o_A 1s6u_A | Back alignment and structure |
|---|
| >3cjk_B Copper-transporting ATPase 1; HAH1, ATP7B, menkes disease, metal homeostasis, chaperone, ION transport, metal- binding, alternative splicing; 1.80A {Homo sapiens} PDB: 2k1r_A | Back alignment and structure |
|---|
| >1yjr_A Copper-transporting ATPase 1; metallochaperone, protein-protein interaction, copper(I), metal homeostasis, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1yjt_A 1yju_A 1yjv_A | Back alignment and structure |
|---|
| >1qup_A Superoxide dismutase 1 copper chaperone; two domains, beta-alpha-beta-BETA-alpha-beta and beta barrel; 1.80A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >2qif_A Copper chaperone COPZ; tetranuclear Cu(I) cluster; 1.50A {Bacillus subtilis} SCOP: d.58.17.1 PDB: 3i9z_A 1k0v_A 1p8g_A | Back alignment and structure |
|---|
| >1kvi_A Copper-transporting ATPase 1; menkes, Cu-protein, hydrolase; NMR {Homo sapiens} SCOP: d.58.17.1 PDB: 1kvj_A | Back alignment and structure |
|---|
| >1fvq_A Copper-transporting ATPase; APO-CCC2A, hydrolase; NMR {Saccharomyces cerevisiae} SCOP: d.58.17.1 PDB: 1fvs_A 2ggp_B | Back alignment and structure |
|---|
| >1y3j_A Copper-transporting ATPase 1; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta structure, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 1y3k_A | Back alignment and structure |
|---|
| >2ldi_A Zinc-transporting ATPase; metal homeostasis, metallochaperones, hydrolase; NMR {Synechocystis SP} | Back alignment and structure |
|---|
| >1mwy_A ZNTA; open-faced beta-sandwich fold, beta-alpha-beta-BETA-alpha- beta, hydrolase; NMR {Escherichia coli} SCOP: d.58.17.1 PDB: 1mwz_A | Back alignment and structure |
|---|
| >1opz_A Potential copper-transporting ATPase; mutation, folding, abbab fold, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 1oq3_A 1oq6_A | Back alignment and structure |
|---|
| >2kyz_A Heavy metal binding protein; structural genomics, PSI-biology, protein structure initiative, joint for structural genomics, JCSG; NMR {Thermotoga maritima} | Back alignment and structure |
|---|
| >1jk9_B CCS, copper chaperone for superoxide dismutase; protein-protein complex, heterodimer, metallochaperone, amyotrophic lateral sclerosis; 2.90A {Saccharomyces cerevisiae} SCOP: b.1.8.1 d.58.17.1 | Back alignment and structure |
|---|
| >1jww_A Potential copper-transporting ATPase; beta-alpha-beta-BETA-alpha-beta, hydrolase; NMR {Bacillus subtilis} SCOP: d.58.17.1 PDB: 2voy_A 1kqk_A | Back alignment and structure |
|---|
| >2kkh_A Putative heavy metal transporter; zinc transport, metal binding, metal selectivity, ferredoxin fold, ATP-binding, hydrolase; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2aj0_A Probable cadmium-transporting ATPase; ferrodoxin-like fold, beta-alpha-beta-BETA-alpha-beta, metal binding protein, hydrolase; NMR {Listeria monocytogenes} PDB: 2aj1_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 271 | ||||
| d1qupa2 | 72 | d.58.17.1 (A:2-73) Copper chaperone for superoxide | 4e-07 | |
| d1cc8a_ | 72 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 6e-06 | |
| d1osda_ | 72 | d.58.17.1 (A:) Mercuric ion binding protein MerP { | 2e-05 | |
| d2ggpb1 | 72 | d.58.17.1 (B:1-72) Copper transporter domain ccc2a | 3e-05 | |
| d1sb6a_ | 64 | d.58.17.1 (A:) Copper chaperone {Synechocystis sp. | 5e-05 | |
| d1fe0a_ | 66 | d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX | 2e-04 | |
| d1p6ta1 | 72 | d.58.17.1 (A:1-72) Potential copper-translocating | 2e-04 | |
| d1kvja_ | 79 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-04 | |
| d2aw0a_ | 72 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 3e-04 | |
| d1mwza_ | 73 | d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, | 0.001 | |
| d1q8la_ | 84 | d.58.17.1 (A:) Menkes copper-transporting ATPase { | 0.002 | |
| d2qifa1 | 69 | d.58.17.1 (A:1-69) Copper chaperone {Bacillus subt | 0.002 | |
| d1p6ta2 | 79 | d.58.17.1 (A:73-151) Potential copper-translocatin | 0.002 |
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: Copper chaperone for superoxide dismutase, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 44.4 bits (105), Expect = 4e-07
Identities = 10/51 (19%), Positives = 27/51 (52%)
Query: 83 TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELV 133
I +HCE C++ IK + G++++ D + +++V+ ++ ++
Sbjct: 7 EATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTII 57
|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} Length = 72 | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 72 | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} Length = 64 | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} Length = 66 | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 72 | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 79 | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 73 | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Length = 84 | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} Length = 69 | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} Length = 79 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 271 | |||
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 99.66 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 99.65 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 99.64 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 99.56 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 99.56 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 99.53 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 99.52 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 99.52 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 99.5 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 99.5 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 99.49 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 99.46 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 99.46 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 99.42 | |
| d1qupa2 | 72 | Copper chaperone for superoxide dismutase, N-termi | 97.98 | |
| d1fe0a_ | 66 | ATX1 metallochaperone protein (ATOX1) {Human (Homo | 97.79 | |
| d1cc8a_ | 72 | ATX1 metallochaperone protein (ATOX1) {Baker's yea | 97.6 | |
| d1sb6a_ | 64 | Copper chaperone {Synechocystis sp. pcc 6803, Scat | 97.59 | |
| d1cpza_ | 68 | Copper chaperone {Enterococcus hirae [TaxId: 1354] | 97.56 | |
| d2ggpb1 | 72 | Copper transporter domain ccc2a {Baker's yeast (Sa | 97.53 | |
| d1kvja_ | 79 | Menkes copper-transporting ATPase {Human (Homo sap | 97.26 | |
| d1osda_ | 72 | Mercuric ion binding protein MerP {Ralstonia metal | 97.24 | |
| d2aw0a_ | 72 | Menkes copper-transporting ATPase {Human (Homo sap | 97.21 | |
| d1q8la_ | 84 | Menkes copper-transporting ATPase {Human (Homo sap | 97.13 | |
| d1p6ta2 | 79 | Potential copper-translocating P-type ATPase CopA | 97.1 | |
| d1p6ta1 | 72 | Potential copper-translocating P-type ATPase CopA | 97.08 | |
| d2qifa1 | 69 | Copper chaperone {Bacillus subtilis, CopZ [TaxId: | 97.02 | |
| d1mwza_ | 73 | Metal ion-transporting ATPase ZntA, N-terminal dom | 96.81 | |
| d1uwda_ | 102 | Hypothetical protein TM0487 {Thermotoga maritima [ | 86.41 |
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Ferredoxin-like superfamily: HMA, heavy metal-associated domain family: HMA, heavy metal-associated domain domain: ATX1 metallochaperone protein (ATOX1) species: Human (Homo sapiens), HAH1 [TaxId: 9606]
Probab=99.66 E-value=9.9e-17 Score=114.98 Aligned_cols=64 Identities=22% Similarity=0.423 Sum_probs=61.1
Q ss_pred eEEEEeeccchhhHHHHHHHhhcCCCccEEEEecCCCEEEEEecCCHHHHHHHHHhhcCCceEEcc
Q 024167 83 TVVLKIRLHCEGCISKIKKIIYKTKGVDNVTIDGGKDLVTVKGTMDVKELVPYLKEKLKRNVEVVP 148 (271)
Q Consensus 83 ~v~l~VgM~C~~Ca~kIekaL~ki~GV~~v~Vd~~~~~VtV~g~~d~~~L~~~l~kk~G~~ae~v~ 148 (271)
+++|+|+|||.+|+++|+++|.+++|| ++.||+.+++|+|+++++++.|+++|+ ++||+++++.
T Consensus 2 k~ef~V~M~C~~C~~~I~~aL~~~~gv-~v~v~~~~~~v~V~~~~~~~~i~~~I~-~~Gy~a~lig 65 (66)
T d1fe0a_ 2 KHEFSVDMTCGGCAEAVSRVLNKLGGV-KYDIDLPNKKVCIESEHSMDTLLATLK-KTGKTVSYLG 65 (66)
T ss_dssp EEEEEECCCSHHHHHHHHHHHHHHCSE-EEEEETTTTEEEEEESSCHHHHHHHHH-TTTSCEEEEE
T ss_pred CEEEEEccCchHHHHHHHHHHhcCCCc-EEEEEcCCCEEEEEeeCCHHHHHHHHH-HhCCeEEEee
Confidence 478999999999999999999999998 699999999999999999999999999 9999999874
|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qupa2 d.58.17.1 (A:2-73) Copper chaperone for superoxide dismutase, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fe0a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Human (Homo sapiens), HAH1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cc8a_ d.58.17.1 (A:) ATX1 metallochaperone protein (ATOX1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sb6a_ d.58.17.1 (A:) Copper chaperone {Synechocystis sp. pcc 6803, Scatx1 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1cpza_ d.58.17.1 (A:) Copper chaperone {Enterococcus hirae [TaxId: 1354]} | Back information, alignment and structure |
|---|
| >d2ggpb1 d.58.17.1 (B:1-72) Copper transporter domain ccc2a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1osda_ d.58.17.1 (A:) Mercuric ion binding protein MerP {Ralstonia metallidurans CH34 [TaxId: 266264]} | Back information, alignment and structure |
|---|
| >d2aw0a_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8la_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p6ta2 d.58.17.1 (A:73-151) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1p6ta1 d.58.17.1 (A:1-72) Potential copper-translocating P-type ATPase CopA (YvgX) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2qifa1 d.58.17.1 (A:1-69) Copper chaperone {Bacillus subtilis, CopZ [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mwza_ d.58.17.1 (A:) Metal ion-transporting ATPase ZntA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uwda_ d.52.8.2 (A:) Hypothetical protein TM0487 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|