Query         024171
Match_columns 271
No_of_seqs    250 out of 1791
Neff          6.5 
Searched_HMMs 46136
Date          Fri Mar 29 02:36:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/024171.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/024171hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PTZ00368 universal minicircle   99.9 1.8E-27   4E-32  198.9  10.0  133   88-261     2-148 (148)
  2 PTZ00368 universal minicircle   99.9 5.9E-26 1.3E-30  189.8   9.5  126   49-188     1-148 (148)
  3 COG5082 AIR1 Arginine methyltr  99.8 3.1E-20 6.8E-25  159.5   6.3  101  131-263    60-175 (190)
  4 COG5082 AIR1 Arginine methyltr  99.8 2.1E-19 4.6E-24  154.3   7.9   83   43-126    55-141 (190)
  5 KOG4400 E3 ubiquitin ligase in  99.7 2.6E-17 5.7E-22  149.6  11.3  191   48-260    24-240 (261)
  6 KOG4400 E3 ubiquitin ligase in  99.6 1.4E-14 3.1E-19  131.7  12.0  179   48-267    54-257 (261)
  7 PF00098 zf-CCHC:  Zinc knuckle  98.2 6.9E-07 1.5E-11   48.9   1.2   17  244-260     2-18  (18)
  8 PF00098 zf-CCHC:  Zinc knuckle  97.9 4.8E-06   1E-10   45.5   1.7   17  224-240     2-18  (18)
  9 PF13696 zf-CCHC_2:  Zinc knuck  96.2  0.0036 7.9E-08   39.1   2.2   19  242-260     8-26  (32)
 10 PF13917 zf-CCHC_3:  Zinc knuck  95.7  0.0055 1.2E-07   40.7   1.5   18  242-259     4-21  (42)
 11 PF13696 zf-CCHC_2:  Zinc knuck  95.7  0.0066 1.4E-07   38.0   1.5   20  169-188     8-27  (32)
 12 smart00343 ZnF_C2HC zinc finge  93.9   0.031 6.8E-07   32.8   1.2   16  245-260     2-17  (26)
 13 KOG0119 Splicing factor 1/bran  92.6   0.082 1.8E-06   52.1   2.6   41  223-263   262-306 (554)
 14 PF13917 zf-CCHC_3:  Zinc knuck  92.1   0.074 1.6E-06   35.3   1.1   19  222-240     4-22  (42)
 15 smart00343 ZnF_C2HC zinc finge  91.6   0.087 1.9E-06   30.9   1.0   17  224-240     1-17  (26)
 16 KOG0109 RNA-binding protein LA  90.7    0.13 2.8E-06   47.8   1.6   19  222-240   160-178 (346)
 17 KOG0119 Splicing factor 1/bran  90.5    0.19 4.1E-06   49.6   2.6   39  151-189   262-305 (554)
 18 PF14392 zf-CCHC_4:  Zinc knuck  90.1    0.12 2.7E-06   35.1   0.7   25   41-65     24-48  (49)
 19 KOG4368 Predicted RNA binding   88.5     0.3 6.4E-06   49.2   2.3   17    3-19    601-617 (757)
 20 KOG0109 RNA-binding protein LA  85.7     0.4 8.8E-06   44.5   1.4   24  242-265   160-183 (346)
 21 PF15288 zf-CCHC_6:  Zinc knuck  85.2    0.69 1.5E-05   30.4   1.9   19  244-262     3-23  (40)
 22 PF14392 zf-CCHC_4:  Zinc knuck  83.9     0.4 8.8E-06   32.5   0.4   18  222-239    31-48  (49)
 23 PF15288 zf-CCHC_6:  Zinc knuck  82.6     0.7 1.5E-05   30.4   1.2   18  223-240     2-21  (40)
 24 PF14787 zf-CCHC_5:  GAG-polypr  80.7     1.1 2.3E-05   28.8   1.4   18   49-66      3-20  (36)
 25 COG5222 Uncharacterized conser  79.5     1.4 3.1E-05   41.2   2.5   22  241-262   175-196 (427)
 26 PF14787 zf-CCHC_5:  GAG-polypr  75.1     1.8   4E-05   27.7   1.3   16  224-239     4-19  (36)
 27 KOG0314 Predicted E3 ubiquitin  73.6     4.9 0.00011   39.6   4.5   23  241-263   157-179 (448)
 28 COG5222 Uncharacterized conser  67.2     2.4 5.1E-05   39.7   0.8   19   48-66    176-194 (427)
 29 KOG0314 Predicted E3 ubiquitin  61.6     9.9 0.00022   37.5   3.9   59   46-104   110-176 (448)
 30 KOG0107 Alternative splicing f  51.1      31 0.00068   30.1   4.8   34  225-264   103-136 (195)
 31 KOG2044 5'-3' exonuclease HKE1  45.6     9.1  0.0002   40.3   0.8   21   45-65    257-277 (931)
 32 KOG0132 RNA polymerase II C-te  38.3      25 0.00054   37.1   2.6   26    3-28    343-368 (894)
 33 KOG4246 Predicted DNA-binding   35.9      13 0.00028   39.4   0.2   17   23-39    344-360 (1194)
 34 PF06495 Transformer:  Fruit fl  29.7      37  0.0008   29.4   1.9   11    4-14     59-69  (182)
 35 PF00937 Corona_nucleoca:  Coro  29.0      19 0.00042   34.5   0.1   14    4-17    164-177 (355)
 36 COG1198 PriA Primosomal protei  28.5      67  0.0015   33.9   4.0   55   41-114   428-484 (730)
 37 KOG2548 SWAP mRNA splicing reg  27.2      29 0.00063   35.0   1.0   12    5-16    388-399 (653)
 38 KOG3116 Predicted C3H1-type Zn  26.9      18  0.0004   30.6  -0.4   19  222-240    27-45  (177)
 39 PF12353 eIF3g:  Eukaryotic tra  24.0      40 0.00087   27.6   1.1   19  221-240   105-123 (128)
 40 KOG2673 Uncharacterized conser  23.5      31 0.00067   34.2   0.4   22  245-266   131-152 (485)
 41 KOG4246 Predicted DNA-binding   23.3      33 0.00071   36.6   0.6   21   24-44    353-373 (1194)
 42 PF12353 eIF3g:  Eukaryotic tra  23.1      52  0.0011   26.9   1.6   22  241-263   105-126 (128)
 43 KOG3973 Uncharacterized conser  22.1      85  0.0018   30.3   3.0   20  201-220   365-384 (465)
 44 PF00684 DnaJ_CXXCXGXG:  DnaJ c  21.0      45 0.00096   23.7   0.7   11  152-162    43-53  (66)
 45 KOG2044 5'-3' exonuclease HKE1  20.6      42 0.00092   35.5   0.8   19  222-240   260-278 (931)
 46 PRK14890 putative Zn-ribbon RN  20.4      99  0.0022   22.0   2.4   10   48-57      7-16  (59)

No 1  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=99.94  E-value=1.8e-27  Score=198.92  Aligned_cols=133  Identities=34%  Similarity=0.819  Sum_probs=92.8

Q ss_pred             cCcCCCCCCCCCCCCCC--------CCccccCCCCCcCCCCCCCCcccCCCCcccccCCCCCCCCcCCCCCccccccCCC
Q 024171           88 RCWNCREPGHMASNCHN--------EGICHSCGKTGHRARDCSTHVQSGGDLRLCNNCYKPGHIAADCTNDKACKNCRKT  159 (271)
Q Consensus        88 ~C~~Cg~~GH~~~~Cp~--------~~~C~~Cg~~GH~~~~Cp~~~~~~~~~~~C~~Cg~~GH~a~dC~~~~~C~~Cg~~  159 (271)
                      +||+|++.||++++||+        ...||+|++.||++++||..... .....|++|++.||++.+||+...     . 
T Consensus         2 ~C~~C~~~GH~~~~c~~~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~~~-~~~~~C~~Cg~~GH~~~~Cp~~~~-----~-   74 (148)
T PTZ00368          2 VCYRCGGVGHQSRECPNSAPAGAAKARPCYKCGEPGHLSRECPSAPGG-RGERSCYNCGKTGHLSRECPEAPP-----G-   74 (148)
T ss_pred             cCCCCCCCCcCcccCcCCCCCCCCCCccCccCCCCCcCcccCcCCCCC-CCCcccCCCCCcCcCcccCCCccc-----C-
Confidence            46666666666666665        24677777777777777765321 123456666666666666654210     0 


Q ss_pred             CcccccCCCCCCCCccccCCcCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCccccccCCCCCcCCCCC
Q 024171          160 GHIARDCQNEPVCNLCNIAGHVARQCPKGDSLGERGGGGGGERGGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCV  239 (271)
Q Consensus       160 GH~~~~Cp~~~~C~~C~~~GH~a~~Cp~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~~dCp  239 (271)
                             .....|++|++.||++++||+....    +                       ....+||+|++.||+++|||
T Consensus        75 -------~~~~~C~~Cg~~GH~~~~C~~~~~~----~-----------------------~~~~~C~~Cg~~gH~~~~C~  120 (148)
T PTZ00368         75 -------SGPRSCYNCGQTGHISRECPNRAKG----G-----------------------AARRACYNCGGEGHISRDCP  120 (148)
T ss_pred             -------CCCcccCcCCCCCcccccCCCcccc----c-----------------------ccchhhcccCcCCcchhcCC
Confidence                   0235799999999999999985421    0                       12478999999999999999


Q ss_pred             CC------CcceEcCCCCCcCCCCCCCC
Q 024171          240 GP------LIICRNCGGRGHMAYECPSG  261 (271)
Q Consensus       240 ~~------~~~C~~Cg~~GH~~~~Cp~~  261 (271)
                      ++      .++||+|+++|||++|||+.
T Consensus       121 ~~~~~~~~~~~C~~Cg~~gH~~~dCp~~  148 (148)
T PTZ00368        121 NAGKRPGGDKTCYNCGQTGHLSRDCPDK  148 (148)
T ss_pred             CccccCCCCCccccCCCcCcccccCCCC
Confidence            84      58999999999999999974


No 2  
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional
Probab=99.93  E-value=5.9e-26  Score=189.83  Aligned_cols=126  Identities=43%  Similarity=0.976  Sum_probs=77.7

Q ss_pred             cccccCCCCCCCCCCCCCC--------cccccCCCCCCccCCCCCcccCcCCCCCCCCCCCCCCCCccccCCCCCcCCCC
Q 024171           49 NLCNNCKRPGHFARECPNV--------AVCNNCGLPGHIASECTTQARCWNCREPGHMASNCHNEGICHSCGKTGHRARD  120 (271)
Q Consensus        49 ~~C~nCg~~GH~~~~Cp~~--------~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~  120 (271)
                      ++||||++.||++++||..        ..||+|+..||++.+||....             -.....|++|++.||++++
T Consensus         1 ~~C~~C~~~GH~~~~c~~~~~~~~~~~~~C~~Cg~~GH~~~~Cp~~~~-------------~~~~~~C~~Cg~~GH~~~~   67 (148)
T PTZ00368          1 MVCYRCGGVGHQSRECPNSAPAGAAKARPCYKCGEPGHLSRECPSAPG-------------GRGERSCYNCGKTGHLSRE   67 (148)
T ss_pred             CcCCCCCCCCcCcccCcCCCCCCCCCCccCccCCCCCcCcccCcCCCC-------------CCCCcccCCCCCcCcCccc
Confidence            5899999999999999972        245555555555555554210             0001235555555555555


Q ss_pred             CCCCcccCCCCcccccCCCCCCCCcCCCCCc-------cccccCCCCcccccCCC-------CCCCCccccCCcCCCCCC
Q 024171          121 CSTHVQSGGDLRLCNNCYKPGHIAADCTNDK-------ACKNCRKTGHIARDCQN-------EPVCNLCNIAGHVARQCP  186 (271)
Q Consensus       121 Cp~~~~~~~~~~~C~~Cg~~GH~a~dC~~~~-------~C~~Cg~~GH~~~~Cp~-------~~~C~~C~~~GH~a~~Cp  186 (271)
                      ||...... ..+.|++|++.||++.+|++..       +||+|++.||++++||+       .++||+|++.|||++|||
T Consensus        68 Cp~~~~~~-~~~~C~~Cg~~GH~~~~C~~~~~~~~~~~~C~~Cg~~gH~~~~C~~~~~~~~~~~~C~~Cg~~gH~~~dCp  146 (148)
T PTZ00368         68 CPEAPPGS-GPRSCYNCGQTGHISRECPNRAKGGAARRACYNCGGEGHISRDCPNAGKRPGGDKTCYNCGQTGHLSRDCP  146 (148)
T ss_pred             CCCcccCC-CCcccCcCCCCCcccccCCCcccccccchhhcccCcCCcchhcCCCccccCCCCCccccCCCcCcccccCC
Confidence            55543211 2345666666666666665422       46666666666666665       368999999999999999


Q ss_pred             CC
Q 024171          187 KG  188 (271)
Q Consensus       187 ~~  188 (271)
                      +.
T Consensus       147 ~~  148 (148)
T PTZ00368        147 DK  148 (148)
T ss_pred             CC
Confidence            73


No 3  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=99.81  E-value=3.1e-20  Score=159.46  Aligned_cols=101  Identities=35%  Similarity=0.807  Sum_probs=54.0

Q ss_pred             CcccccCCCCCCCCcCCCCCccccccCCCCcccccCCCCCCCCccccCCcCCCCC-CCCCCCCCCCCCCCCCCCCCCCCC
Q 024171          131 LRLCNNCYKPGHIAADCTNDKACKNCRKTGHIARDCQNEPVCNLCNIAGHVARQC-PKGDSLGERGGGGGGERGGGGGGD  209 (271)
Q Consensus       131 ~~~C~~Cg~~GH~a~dC~~~~~C~~Cg~~GH~~~~Cp~~~~C~~C~~~GH~a~~C-p~~~~~~~~~~~~~~~~~~~~g~~  209 (271)
                      .+.|++|++.||++.||| ..+|++|...+|.+..||..++|++|++.||++++| |..+                    
T Consensus        60 ~~~C~nCg~~GH~~~DCP-~~iC~~C~~~~H~s~~C~~~~~C~~Cg~~GH~~~dC~P~~~--------------------  118 (190)
T COG5082          60 NPVCFNCGQNGHLRRDCP-HSICYNCSWDGHRSNHCPKPKKCYNCGETGHLSRDCNPSKD--------------------  118 (190)
T ss_pred             ccccchhcccCcccccCC-hhHhhhcCCCCcccccCCcccccccccccCccccccCcccc--------------------
Confidence            345555555555555555 345555544555555555555555555555555555 3322                    


Q ss_pred             CCCCCCCCCcccCccccccCCCCCcCCCCCC--------------CCcceEcCCCCCcCCCCCCCCCc
Q 024171          210 GGGGGGRYVGYHDVICRSCNQMGHMSRDCVG--------------PLIICRNCGGRGHMAYECPSGRI  263 (271)
Q Consensus       210 ~~~~~~~~~~~~~~~C~~C~~~gH~~~dCp~--------------~~~~C~~Cg~~GH~~~~Cp~~~~  263 (271)
                                 ..+.|+.|...+|.+++||.              ..+.||+|+..+||+.||+.++.
T Consensus       119 -----------~~~~C~~C~s~~H~s~~Cp~~~k~y~~~~~~~~~~~~~cy~c~~~~H~~~dc~~~~~  175 (190)
T COG5082         119 -----------QQKSCFDCNSTRHSSEDCPSIWKHYVLNNGDGHPIKKFCYSCGSAGHFGDDCKEPRS  175 (190)
T ss_pred             -----------cCcceeccCCCccccccCcccccccccccCCCcceeeeccccCCccccCCCCCCCcc
Confidence                       12445555555555555554              24556666666666666665443


No 4  
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion]
Probab=99.79  E-value=2.1e-19  Score=154.32  Aligned_cols=83  Identities=33%  Similarity=0.897  Sum_probs=74.6

Q ss_pred             ccCCCCcccccCCCCCCCCCCCCCCcccccCCCCCCccCCCCCcccCcCCCCCCCCCCCC-CCC---CccccCCCCCcCC
Q 024171           43 RSFSQGNLCNNCKRPGHFARECPNVAVCNNCGLPGHIASECTTQARCWNCREPGHMASNC-HNE---GICHSCGKTGHRA  118 (271)
Q Consensus        43 ~~~~~~~~C~nCg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~C-p~~---~~C~~Cg~~GH~~  118 (271)
                      .......+||||++.||+++||| ..+|++|...||.+..||..++|++|++.||++++| |..   ..|+.|....|++
T Consensus        55 ~~~~~~~~C~nCg~~GH~~~DCP-~~iC~~C~~~~H~s~~C~~~~~C~~Cg~~GH~~~dC~P~~~~~~~C~~C~s~~H~s  133 (190)
T COG5082          55 AIREENPVCFNCGQNGHLRRDCP-HSICYNCSWDGHRSNHCPKPKKCYNCGETGHLSRDCNPSKDQQKSCFDCNSTRHSS  133 (190)
T ss_pred             cccccccccchhcccCcccccCC-hhHhhhcCCCCcccccCCcccccccccccCccccccCcccccCcceeccCCCcccc
Confidence            33445789999999999999999 679999988999999999988999999999999999 553   4799999999999


Q ss_pred             CCCCCCcc
Q 024171          119 RDCSTHVQ  126 (271)
Q Consensus       119 ~~Cp~~~~  126 (271)
                      .+||.+|+
T Consensus       134 ~~Cp~~~k  141 (190)
T COG5082         134 EDCPSIWK  141 (190)
T ss_pred             ccCccccc
Confidence            99999997


No 5  
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.72  E-value=2.6e-17  Score=149.56  Aligned_cols=191  Identities=30%  Similarity=0.625  Sum_probs=144.8

Q ss_pred             CcccccCCCCCCCCCCCCCCc-----------ccccCCCCCCccCCCCCcccCcCCCCCCCCCCCCCC-CCccccCCCCC
Q 024171           48 GNLCNNCKRPGHFARECPNVA-----------VCNNCGLPGHIASECTTQARCWNCREPGHMASNCHN-EGICHSCGKTG  115 (271)
Q Consensus        48 ~~~C~nCg~~GH~~~~Cp~~~-----------~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~-~~~C~~Cg~~G  115 (271)
                      ...++.+.+.+|.+..|+...           .+..+...+|....++. ..|+.|++.||+..+|+. ...|++|++.|
T Consensus        24 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~c~~~g~~~~~~~~~~~~~~~c~~C~~~g  102 (261)
T KOG4400|consen   24 SPNELKCLKSGHKAVSCTDGDSRGDSSKSDGPGCVSTSPNGPLKSECPE-VSCYICGEKGHLGRRCTRIAAACFNCGEGG  102 (261)
T ss_pred             chhhhhhccccCcceecccCCcccccccCCCCcccccccCcccCCCCCC-ceeeecCCCCchhhcCcccchhhhhCCCCc
Confidence            578899999999999998642           34445566777777776 799999999999999996 67899999999


Q ss_pred             cCCCCCCCCcccCCCCcccccCCCCCCCC-cCCC-----CCccccccCCCCcccccCCC--CCCCCccccCCcCCCCCCC
Q 024171          116 HRARDCSTHVQSGGDLRLCNNCYKPGHIA-ADCT-----NDKACKNCRKTGHIARDCQN--EPVCNLCNIAGHVARQCPK  187 (271)
Q Consensus       116 H~~~~Cp~~~~~~~~~~~C~~Cg~~GH~a-~dC~-----~~~~C~~Cg~~GH~~~~Cp~--~~~C~~C~~~GH~a~~Cp~  187 (271)
                      |++++||.++........|+.|++.||.. .++.     ....||+|++.||++.+||.  ...||.|++.+|++++||.
T Consensus       103 H~~~~c~~~~~~~~~~~~~~~c~~~gh~~~~~~~~~~~~~~~~Cy~Cg~~GH~s~~C~~~~~~~c~~c~~~~h~~~~C~~  182 (261)
T KOG4400|consen  103 HIERDCPEAGKEGSSETSCYSCGKTGHRGCPDADPVDGPKPAKCYSCGEQGHISDDCPENKGGTCFRCGKVGHGSRDCPS  182 (261)
T ss_pred             cchhhCCcccCcccccceeeccCCCccccCcccccccCCCCCccCCCCcCCcchhhCCCCCCCccccCCCcceecccCCc
Confidence            99999999987433455789999999999 3332     22459999999999999994  7899999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCccccccCCCCCcCCCCCC------CCcceEcCCCCCcCCCCCCC
Q 024171          188 GDSLGERGGGGGGERGGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCVG------PLIICRNCGGRGHMAYECPS  260 (271)
Q Consensus       188 ~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~~dCp~------~~~~C~~Cg~~GH~~~~Cp~  260 (271)
                      ...........                  .  ..--.++ +...+|+.++++.      ....+|++...+|.+.+|-+
T Consensus       183 ~~~~~~~~~~~------------------~--~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  240 (261)
T KOG4400|consen  183 KQKSKSKQGGQ------------------R--KGFGACY-DYPQGHKQRACGGSGPDDNFNDSCYNKLSSGKLDQDCKQ  240 (261)
T ss_pred             cccccccCccc------------------c--cccccCc-cccccccccccCCCCcccccccccccccccccccchhhh
Confidence            87532111100                  0  0111233 5678888888875      35667777766666665543


No 6  
>KOG4400 consensus E3 ubiquitin ligase interacting with arginine methyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.58  E-value=1.4e-14  Score=131.68  Aligned_cols=179  Identities=33%  Similarity=0.694  Sum_probs=131.8

Q ss_pred             CcccccCCCCCCCCCCCCCCcccccCCCCCCccCCCCC-cccCcCCCCCCCCCCCCCCCC-------ccccCCCCCcCC-
Q 024171           48 GNLCNNCKRPGHFARECPNVAVCNNCGLPGHIASECTT-QARCWNCREPGHMASNCHNEG-------ICHSCGKTGHRA-  118 (271)
Q Consensus        48 ~~~C~nCg~~GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~-~~~C~~Cg~~GH~~~~Cp~~~-------~C~~Cg~~GH~~-  118 (271)
                      ...+..+...+|+...++.. .|+.|++.+|....|+. ...|++|++.||++++|++..       .||.|+..+|.. 
T Consensus        54 ~~~~~~~~~~~~~~~~~~~~-~c~~~g~~~~~~~~~~~~~~~c~~C~~~gH~~~~c~~~~~~~~~~~~~~~c~~~gh~~~  132 (261)
T KOG4400|consen   54 GPGCVSTSPNGPLKSECPEV-SCYICGEKGHLGRRCTRIAAACFNCGEGGHIERDCPEAGKEGSSETSCYSCGKTGHRGC  132 (261)
T ss_pred             CCcccccccCcccCCCCCCc-eeeecCCCCchhhcCcccchhhhhCCCCccchhhCCcccCcccccceeeccCCCccccC
Confidence            34556678888888888875 89999999999999985 578999999999999999852       578999999999 


Q ss_pred             CCCCCCcccCCCCcccccCCCCCCCCcCCCC--CccccccCCCCcccccCCCCC--------------CCCccccCCcCC
Q 024171          119 RDCSTHVQSGGDLRLCNNCYKPGHIAADCTN--DKACKNCRKTGHIARDCQNEP--------------VCNLCNIAGHVA  182 (271)
Q Consensus       119 ~~Cp~~~~~~~~~~~C~~Cg~~GH~a~dC~~--~~~C~~Cg~~GH~~~~Cp~~~--------------~C~~C~~~GH~a  182 (271)
                      .++..... +.. +.||+|++.||+..+||+  ...|+.|+..+|++++||...              .++ +...+|+.
T Consensus       133 ~~~~~~~~-~~~-~~Cy~Cg~~GH~s~~C~~~~~~~c~~c~~~~h~~~~C~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  209 (261)
T KOG4400|consen  133 PDADPVDG-PKP-AKCYSCGEQGHISDDCPENKGGTCFRCGKVGHGSRDCPSKQKSKSKQGGQRKGFGACY-DYPQGHKQ  209 (261)
T ss_pred             cccccccC-CCC-CccCCCCcCCcchhhCCCCCCCccccCCCcceecccCCccccccccCcccccccccCc-cccccccc
Confidence            33322211 112 679999999999999994  578999999999999999521              233 34566777


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCcccCccccccCCCCCcCCCCCCCCcceEcCCCCCcCCCCCCCCC
Q 024171          183 RQCPKGDSLGERGGGGGGERGGGGGGDGGGGGGRYVGYHDVICRSCNQMGHMSRDCVGPLIICRNCGGRGHMAYECPSGR  262 (271)
Q Consensus       183 ~~Cp~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~C~~C~~~gH~~~dCp~~~~~C~~Cg~~GH~~~~Cp~~~  262 (271)
                      ++++......                           .....+|++...+|.+.+|          .+.++++++|...+
T Consensus       210 ~~~~~~~~~~---------------------------~~~~~~~~~~~~~~~~~~~----------~~~~~~~~~~~~~~  252 (261)
T KOG4400|consen  210 RACGGSGPDD---------------------------NFNDSCYNKLSSGKLDQDC----------KQSSMKSNSCGTKR  252 (261)
T ss_pred             cccCCCCccc---------------------------ccccccccccccccccchh----------hhhccccccccchh
Confidence            6665544311                           1247789999888888777          45556666666555


Q ss_pred             cCCCC
Q 024171          263 IADRG  267 (271)
Q Consensus       263 ~~~~~  267 (271)
                      +....
T Consensus       253 ~~~~~  257 (261)
T KOG4400|consen  253 LFYNT  257 (261)
T ss_pred             hcccc
Confidence            55544


No 7  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=98.18  E-value=6.9e-07  Score=48.87  Aligned_cols=17  Identities=53%  Similarity=1.253  Sum_probs=10.0

Q ss_pred             ceEcCCCCCcCCCCCCC
Q 024171          244 ICRNCGGRGHMAYECPS  260 (271)
Q Consensus       244 ~C~~Cg~~GH~~~~Cp~  260 (271)
                      .||+|++.||+++|||+
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            45666666666666653


No 8  
>PF00098 zf-CCHC:  Zinc knuckle;  InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the CysCysHisCys (CCHC) type zinc finger domains, and have the sequence:  C-X2-C-X4-H-X4-C  where X can be any amino acid, and number indicates the number of residues. These 18 residues CCHC zinc finger domains are mainly found in the nucleocapsid protein of retroviruses. It is required for viral genome packaging and for early infection process [, , ]. It is also found in eukaryotic proteins involved in RNA binding or single-stranded DNA binding []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding; PDB: 2L44_A 1A1T_A 1WWG_A 1U6P_A 1WWD_A 1WWE_A 1A6B_B 1F6U_A 1MFS_A 1NCP_C ....
Probab=97.95  E-value=4.8e-06  Score=45.50  Aligned_cols=17  Identities=41%  Similarity=1.028  Sum_probs=16.0

Q ss_pred             cccccCCCCCcCCCCCC
Q 024171          224 ICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       224 ~C~~C~~~gH~~~dCp~  240 (271)
                      +||+|+++||+++|||+
T Consensus         2 ~C~~C~~~GH~~~~Cp~   18 (18)
T PF00098_consen    2 KCFNCGEPGHIARDCPK   18 (18)
T ss_dssp             BCTTTSCSSSCGCTSSS
T ss_pred             cCcCCCCcCcccccCcc
Confidence            69999999999999984


No 9  
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=96.23  E-value=0.0036  Score=39.10  Aligned_cols=19  Identities=37%  Similarity=1.097  Sum_probs=12.1

Q ss_pred             CcceEcCCCCCcCCCCCCC
Q 024171          242 LIICRNCGGRGHMAYECPS  260 (271)
Q Consensus       242 ~~~C~~Cg~~GH~~~~Cp~  260 (271)
                      .-+|+.|++.|||..|||+
T Consensus         8 ~Y~C~~C~~~GH~i~dCP~   26 (32)
T PF13696_consen    8 GYVCHRCGQKGHWIQDCPT   26 (32)
T ss_pred             CCEeecCCCCCccHhHCCC
Confidence            4556666666666666665


No 10 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=95.74  E-value=0.0055  Score=40.71  Aligned_cols=18  Identities=50%  Similarity=1.383  Sum_probs=13.5

Q ss_pred             CcceEcCCCCCcCCCCCC
Q 024171          242 LIICRNCGGRGHMAYECP  259 (271)
Q Consensus       242 ~~~C~~Cg~~GH~~~~Cp  259 (271)
                      .+.|.+|++.|||..|||
T Consensus         4 ~~~CqkC~~~GH~tyeC~   21 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECP   21 (42)
T ss_pred             CCcCcccCCCCcchhhCC
Confidence            466777777777777777


No 11 
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=95.65  E-value=0.0066  Score=37.95  Aligned_cols=20  Identities=35%  Similarity=0.846  Sum_probs=14.4

Q ss_pred             CCCCCccccCCcCCCCCCCC
Q 024171          169 EPVCNLCNIAGHVARQCPKG  188 (271)
Q Consensus       169 ~~~C~~C~~~GH~a~~Cp~~  188 (271)
                      .-+|+.|+++||+..|||++
T Consensus         8 ~Y~C~~C~~~GH~i~dCP~~   27 (32)
T PF13696_consen    8 GYVCHRCGQKGHWIQDCPTN   27 (32)
T ss_pred             CCEeecCCCCCccHhHCCCC
Confidence            45677777777777777773


No 12 
>smart00343 ZnF_C2HC zinc finger.
Probab=93.87  E-value=0.031  Score=32.82  Aligned_cols=16  Identities=56%  Similarity=1.425  Sum_probs=11.3

Q ss_pred             eEcCCCCCcCCCCCCC
Q 024171          245 CRNCGGRGHMAYECPS  260 (271)
Q Consensus       245 C~~Cg~~GH~~~~Cp~  260 (271)
                      |++|++.||++.+||+
T Consensus         2 C~~CG~~GH~~~~C~~   17 (26)
T smart00343        2 CYNCGKEGHIARDCPK   17 (26)
T ss_pred             CccCCCCCcchhhCCc
Confidence            6777777777777763


No 13 
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]
Probab=92.64  E-value=0.082  Score=52.07  Aligned_cols=41  Identities=34%  Similarity=0.865  Sum_probs=36.1

Q ss_pred             ccccccCCCCCcCCCCCCC----CcceEcCCCCCcCCCCCCCCCc
Q 024171          223 VICRSCNQMGHMSRDCVGP----LIICRNCGGRGHMAYECPSGRI  263 (271)
Q Consensus       223 ~~C~~C~~~gH~~~dCp~~----~~~C~~Cg~~GH~~~~Cp~~~~  263 (271)
                      ..|.+|+..||..-|||..    ..+|..|+..|||+.||+...+
T Consensus       262 ~~c~~cg~~~H~q~~cp~r~~~~~n~c~~cg~~gH~~~dc~~~~q  306 (554)
T KOG0119|consen  262 RACRNCGSTGHKQYDCPGRIPNTTNVCKICGPLGHISIDCKVNDQ  306 (554)
T ss_pred             ccccccCCCccccccCCcccccccccccccCCcccccccCCCccc
Confidence            5799999999999999972    3499999999999999998733


No 14 
>PF13917 zf-CCHC_3:  Zinc knuckle
Probab=92.06  E-value=0.074  Score=35.33  Aligned_cols=19  Identities=37%  Similarity=0.896  Sum_probs=17.3

Q ss_pred             CccccccCCCCCcCCCCCC
Q 024171          222 DVICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       222 ~~~C~~C~~~gH~~~dCp~  240 (271)
                      ...|.+|++.|||..+||+
T Consensus         4 ~~~CqkC~~~GH~tyeC~~   22 (42)
T PF13917_consen    4 RVRCQKCGQKGHWTYECPN   22 (42)
T ss_pred             CCcCcccCCCCcchhhCCC
Confidence            4789999999999999993


No 15 
>smart00343 ZnF_C2HC zinc finger.
Probab=91.64  E-value=0.087  Score=30.90  Aligned_cols=17  Identities=41%  Similarity=1.060  Sum_probs=15.5

Q ss_pred             cccccCCCCCcCCCCCC
Q 024171          224 ICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       224 ~C~~C~~~gH~~~dCp~  240 (271)
                      .|++|++.||++++||+
T Consensus         1 ~C~~CG~~GH~~~~C~~   17 (26)
T smart00343        1 KCYNCGKEGHIARDCPK   17 (26)
T ss_pred             CCccCCCCCcchhhCCc
Confidence            48999999999999984


No 16 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=90.71  E-value=0.13  Score=47.76  Aligned_cols=19  Identities=32%  Similarity=0.735  Sum_probs=11.8

Q ss_pred             CccccccCCCCCcCCCCCC
Q 024171          222 DVICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       222 ~~~C~~C~~~gH~~~dCp~  240 (271)
                      ...||.|+++|||+.+||.
T Consensus       160 q~~cyrcGkeghwskEcP~  178 (346)
T KOG0109|consen  160 QSGCYRCGKEGHWSKECPV  178 (346)
T ss_pred             HHHheeccccccccccCCc
Confidence            3556666666666666663


No 17 
>KOG0119 consensus Splicing factor 1/branch point binding protein (RRM superfamily) [RNA processing and modification]
Probab=90.49  E-value=0.19  Score=49.60  Aligned_cols=39  Identities=41%  Similarity=0.997  Sum_probs=27.2

Q ss_pred             ccccccCCCCcccccCCCC-----CCCCccccCCcCCCCCCCCC
Q 024171          151 KACKNCRKTGHIARDCQNE-----PVCNLCNIAGHVARQCPKGD  189 (271)
Q Consensus       151 ~~C~~Cg~~GH~~~~Cp~~-----~~C~~C~~~GH~a~~Cp~~~  189 (271)
                      ..|.+|+..||...+||..     .+|..|+..||++.||+...
T Consensus       262 ~~c~~cg~~~H~q~~cp~r~~~~~n~c~~cg~~gH~~~dc~~~~  305 (554)
T KOG0119|consen  262 RACRNCGSTGHKQYDCPGRIPNTTNVCKICGPLGHISIDCKVND  305 (554)
T ss_pred             ccccccCCCccccccCCcccccccccccccCCcccccccCCCcc
Confidence            3566666666666666642     27888888888888887763


No 18 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=90.05  E-value=0.12  Score=35.10  Aligned_cols=25  Identities=32%  Similarity=0.679  Sum_probs=20.6

Q ss_pred             ccccCCCCcccccCCCCCCCCCCCC
Q 024171           41 TRRSFSQGNLCNNCKRPGHFARECP   65 (271)
Q Consensus        41 ~~~~~~~~~~C~nCg~~GH~~~~Cp   65 (271)
                      ...++..+..|++|+..||...+||
T Consensus        24 ~v~YE~lp~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   24 KVKYERLPRFCFHCGRIGHSDKECP   48 (49)
T ss_pred             EEEECCcChhhcCCCCcCcCHhHcC
Confidence            3455666889999999999999997


No 19 
>KOG4368 consensus Predicted RNA binding protein, contains SWAP, RPR and G-patch domains [General function prediction only]
Probab=88.45  E-value=0.3  Score=49.15  Aligned_cols=17  Identities=82%  Similarity=0.837  Sum_probs=8.1

Q ss_pred             CccccccccccCCCCCC
Q 024171            3 SRSRSISRSRSRSRSRS   19 (271)
Q Consensus         3 ~~~~~~~~~~~~~~~~~   19 (271)
                      +|+|++|++|||||++.
T Consensus       601 ~RdrsrskSRSRSpS~~  617 (757)
T KOG4368|consen  601 SRSRSRSKSRSRSPSRS  617 (757)
T ss_pred             ccccccccccCCCcccc
Confidence            44444444444444443


No 20 
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only]
Probab=85.66  E-value=0.4  Score=44.55  Aligned_cols=24  Identities=38%  Similarity=0.780  Sum_probs=20.6

Q ss_pred             CcceEcCCCCCcCCCCCCCCCcCC
Q 024171          242 LIICRNCGGRGHMAYECPSGRIAD  265 (271)
Q Consensus       242 ~~~C~~Cg~~GH~~~~Cp~~~~~~  265 (271)
                      .-.||.||.+|||+.|||..+..+
T Consensus       160 q~~cyrcGkeghwskEcP~~~~~r  183 (346)
T KOG0109|consen  160 QSGCYRCGKEGHWSKECPVDRTGR  183 (346)
T ss_pred             HHHheeccccccccccCCccCCCc
Confidence            468999999999999999876543


No 21 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=85.23  E-value=0.69  Score=30.40  Aligned_cols=19  Identities=47%  Similarity=1.006  Sum_probs=8.9

Q ss_pred             ceEcCCCCCcCC--CCCCCCC
Q 024171          244 ICRNCGGRGHMA--YECPSGR  262 (271)
Q Consensus       244 ~C~~Cg~~GH~~--~~Cp~~~  262 (271)
                      .|.+||..||+.  +.||...
T Consensus         3 kC~~CG~~GH~~t~k~CP~~~   23 (40)
T PF15288_consen    3 KCKNCGAFGHMRTNKRCPMYC   23 (40)
T ss_pred             cccccccccccccCccCCCCC
Confidence            444555555544  3355443


No 22 
>PF14392 zf-CCHC_4:  Zinc knuckle
Probab=83.85  E-value=0.4  Score=32.52  Aligned_cols=18  Identities=28%  Similarity=0.909  Sum_probs=10.7

Q ss_pred             CccccccCCCCCcCCCCC
Q 024171          222 DVICRSCNQMGHMSRDCV  239 (271)
Q Consensus       222 ~~~C~~C~~~gH~~~dCp  239 (271)
                      +..|++|+..||...+||
T Consensus        31 p~~C~~C~~~gH~~~~C~   48 (49)
T PF14392_consen   31 PRFCFHCGRIGHSDKECP   48 (49)
T ss_pred             ChhhcCCCCcCcCHhHcC
Confidence            345666666666666665


No 23 
>PF15288 zf-CCHC_6:  Zinc knuckle
Probab=82.63  E-value=0.7  Score=30.37  Aligned_cols=18  Identities=39%  Similarity=1.017  Sum_probs=15.7

Q ss_pred             ccccccCCCCCcC--CCCCC
Q 024171          223 VICRSCNQMGHMS--RDCVG  240 (271)
Q Consensus       223 ~~C~~C~~~gH~~--~dCp~  240 (271)
                      ++|.+||..||++  +.||.
T Consensus         2 ~kC~~CG~~GH~~t~k~CP~   21 (40)
T PF15288_consen    2 VKCKNCGAFGHMRTNKRCPM   21 (40)
T ss_pred             ccccccccccccccCccCCC
Confidence            6899999999998  56984


No 24 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=80.71  E-value=1.1  Score=28.80  Aligned_cols=18  Identities=39%  Similarity=0.898  Sum_probs=9.3

Q ss_pred             cccccCCCCCCCCCCCCC
Q 024171           49 NLCNNCKRPGHFARECPN   66 (271)
Q Consensus        49 ~~C~nCg~~GH~~~~Cp~   66 (271)
                      ..|+.|++..||+.+|-.
T Consensus         3 ~~CprC~kg~Hwa~~C~s   20 (36)
T PF14787_consen    3 GLCPRCGKGFHWASECRS   20 (36)
T ss_dssp             -C-TTTSSSCS-TTT---
T ss_pred             ccCcccCCCcchhhhhhh
Confidence            467777777777777743


No 25 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=79.53  E-value=1.4  Score=41.17  Aligned_cols=22  Identities=36%  Similarity=1.028  Sum_probs=14.3

Q ss_pred             CCcceEcCCCCCcCCCCCCCCC
Q 024171          241 PLIICRNCGGRGHMAYECPSGR  262 (271)
Q Consensus       241 ~~~~C~~Cg~~GH~~~~Cp~~~  262 (271)
                      +.-.||+||+.|||...||...
T Consensus       175 pgY~CyRCGqkgHwIqnCpTN~  196 (427)
T COG5222         175 PGYVCYRCGQKGHWIQNCPTNQ  196 (427)
T ss_pred             CceeEEecCCCCchhhcCCCCC
Confidence            4566777777777777776543


No 26 
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=75.14  E-value=1.8  Score=27.70  Aligned_cols=16  Identities=25%  Similarity=0.750  Sum_probs=6.4

Q ss_pred             cccccCCCCCcCCCCC
Q 024171          224 ICRSCNQMGHMSRDCV  239 (271)
Q Consensus       224 ~C~~C~~~gH~~~dCp  239 (271)
                      .|.+|++-.|||+||-
T Consensus         4 ~CprC~kg~Hwa~~C~   19 (36)
T PF14787_consen    4 LCPRCGKGFHWASECR   19 (36)
T ss_dssp             C-TTTSSSCS-TTT--
T ss_pred             cCcccCCCcchhhhhh
Confidence            3555555555555553


No 27 
>KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=73.57  E-value=4.9  Score=39.63  Aligned_cols=23  Identities=26%  Similarity=0.509  Sum_probs=13.0

Q ss_pred             CCcceEcCCCCCcCCCCCCCCCc
Q 024171          241 PLIICRNCGGRGHMAYECPSGRI  263 (271)
Q Consensus       241 ~~~~C~~Cg~~GH~~~~Cp~~~~  263 (271)
                      +...||+|...|||...||....
T Consensus       157 psy~c~rc~~~g~wikacptv~~  179 (448)
T KOG0314|consen  157 PSYKCVKCPTPGPWIKACPTVSG  179 (448)
T ss_pred             CCcceecCCCCCccceeccccCC
Confidence            44556666666666666655443


No 28 
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=67.19  E-value=2.4  Score=39.74  Aligned_cols=19  Identities=37%  Similarity=1.158  Sum_probs=17.3

Q ss_pred             CcccccCCCCCCCCCCCCC
Q 024171           48 GNLCNNCKRPGHFARECPN   66 (271)
Q Consensus        48 ~~~C~nCg~~GH~~~~Cp~   66 (271)
                      .-+||.||+.|||..+||.
T Consensus       176 gY~CyRCGqkgHwIqnCpT  194 (427)
T COG5222         176 GYVCYRCGQKGHWIQNCPT  194 (427)
T ss_pred             ceeEEecCCCCchhhcCCC
Confidence            3589999999999999986


No 29 
>KOG0314 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=61.61  E-value=9.9  Score=37.53  Aligned_cols=59  Identities=25%  Similarity=0.540  Sum_probs=42.1

Q ss_pred             CCCcccccCCCCCCCCCCCCC--CcccccCCCCCCccCCCCC------cccCcCCCCCCCCCCCCCC
Q 024171           46 SQGNLCNNCKRPGHFARECPN--VAVCNNCGLPGHIASECTT------QARCWNCREPGHMASNCHN  104 (271)
Q Consensus        46 ~~~~~C~nCg~~GH~~~~Cp~--~~~C~~Cg~~GH~~~~Cp~------~~~C~~Cg~~GH~~~~Cp~  104 (271)
                      ....+++.+++.||..+.+..  ..+|..|-..+|+-..+..      ...|++|..+||+...||.
T Consensus       110 p~~q~~~~~~~~~~~~~~~t~~~~~~~~~~~~~~~~iq~~~~~g~Pppsy~c~rc~~~g~wikacpt  176 (448)
T KOG0314|consen  110 PLIQMNGRMGGRGFGMRRQTPPPGYVCHRCNSPGHFIQHCSTNGSPPPSYKCVKCPTPGPWIKACPT  176 (448)
T ss_pred             chhhhccccccCCcccccCCCcccceeeecccCccccccccccCCCCCCcceecCCCCCccceeccc
Confidence            335678888888888888843  3577788888887776654      2467777777777777775


No 30 
>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification]
Probab=51.13  E-value=31  Score=30.08  Aligned_cols=34  Identities=24%  Similarity=0.490  Sum_probs=24.3

Q ss_pred             ccccCCCCCcCCCCCCCCcceEcCCCCCcCCCCCCCCCcC
Q 024171          225 CRSCNQMGHMSRDCVGPLIICRNCGGRGHMAYECPSGRIA  264 (271)
Q Consensus       225 C~~C~~~gH~~~dCp~~~~~C~~Cg~~GH~~~~Cp~~~~~  264 (271)
                      ||.|++.||+.+.|-+    +|.+  .++....+-.+.-+
T Consensus       103 ~~r~G~rg~~~r~~~~----sy~r--~~r~~~rrrs~~rs  136 (195)
T KOG0107|consen  103 CYRCGERGHIGRNCKD----SYSR--RSRSPRRRRSPSRS  136 (195)
T ss_pred             cccCCCcccccccccc----cccc--cCCCcccccCCCCC
Confidence            9999999999999864    4444  46666666555544


No 31 
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification]
Probab=45.58  E-value=9.1  Score=40.29  Aligned_cols=21  Identities=29%  Similarity=0.635  Sum_probs=10.9

Q ss_pred             CCCCcccccCCCCCCCCCCCC
Q 024171           45 FSQGNLCNNCKRPGHFARECP   65 (271)
Q Consensus        45 ~~~~~~C~nCg~~GH~~~~Cp   65 (271)
                      +.++..||.|+++||.+.+|.
T Consensus       257 P~~~~~C~~cgq~gh~~~dc~  277 (931)
T KOG2044|consen  257 PNKPRRCFLCGQTGHEAKDCE  277 (931)
T ss_pred             CCCcccchhhcccCCcHhhcC
Confidence            344445555555555555554


No 32 
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription]
Probab=38.25  E-value=25  Score=37.06  Aligned_cols=26  Identities=54%  Similarity=0.507  Sum_probs=11.1

Q ss_pred             CccccccccccCCCCCCcchhhhhcc
Q 024171            3 SRSRSISRSRSRSRSRSPRDRRFRSR   28 (271)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~   28 (271)
                      +|+++.+++.|+++.++..+++.+++
T Consensus       343 ~r~r~~~~s~s~~~~~r~~RsrS~sr  368 (894)
T KOG0132|consen  343 SRSRSAPASASRSRRGRLSRSRSRSR  368 (894)
T ss_pred             CCcCCCCcccccccccccccccCCCc
Confidence            34444444444444444444444443


No 33 
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only]
Probab=35.90  E-value=13  Score=39.42  Aligned_cols=17  Identities=41%  Similarity=0.417  Sum_probs=6.8

Q ss_pred             hhhhcccccCCCCCcch
Q 024171           23 RRFRSRHSSYCDPPLRR   39 (271)
Q Consensus        23 ~~~~~~~~~~~~~~~~r   39 (271)
                      ++.+++|.-+.+.|++|
T Consensus       344 sr~rs~rRErer~prRr  360 (1194)
T KOG4246|consen  344 SRQRSRRRERERIPRRR  360 (1194)
T ss_pred             ccccccchhhhcchHhh
Confidence            33333333344444433


No 34 
>PF06495 Transformer:  Fruit fly transformer protein;  InterPro: IPR010519 This family consists of transformer proteins from several Drosophila species and also from Ceratitis capitata (Mediterranean fruit fly). The transformer locus (tra) produces an RNA processing protein that alternatively splices the doublesex pre-mRNA in the sex determination hierarchy of Drosophila melanogaster [].; GO: 0006397 mRNA processing, 0046660 female sex differentiation, 0005634 nucleus
Probab=29.67  E-value=37  Score=29.40  Aligned_cols=11  Identities=91%  Similarity=0.972  Sum_probs=4.4

Q ss_pred             ccccccccccC
Q 024171            4 RSRSISRSRSR   14 (271)
Q Consensus         4 ~~~~~~~~~~~   14 (271)
                      |++|+|++++|
T Consensus        59 RSRSRSrSr~R   69 (182)
T PF06495_consen   59 RSRSRSRSRSR   69 (182)
T ss_pred             ccccccccccc
Confidence            33444444433


No 35 
>PF00937 Corona_nucleoca:  Coronavirus nucleocapsid protein;  InterPro: IPR001218 The entry represents the Coronavirus nucleocapsid protein. Sequence comparison of the N genes of five strains of the coronavirus Murine hepatitis virus suggests a three domain structure for the nucleocapsid protein []. There seems to be a specific interaction between the coronavirus Mouse hepatitis virus A59 nucleocapsid protein and packaging signal [].; GO: 0019013 viral nucleocapsid; PDB: 2GE7_A 2GEC_A 2GE8_B 2BXX_B 2BTL_A 2CA1_B 3HD4_A 2C86_A 2CJR_F 2OG3_A ....
Probab=28.97  E-value=19  Score=34.48  Aligned_cols=14  Identities=79%  Similarity=0.778  Sum_probs=0.0

Q ss_pred             ccccccccccCCCC
Q 024171            4 RSRSISRSRSRSRS   17 (271)
Q Consensus         4 ~~~~~~~~~~~~~~   17 (271)
                      +||+.||+.|||.+
T Consensus       164 ~Sr~~SRs~SRs~S  177 (355)
T PF00937_consen  164 RSRSNSRSSSRSQS  177 (355)
T ss_dssp             --------------
T ss_pred             CCCCCccccccccc
Confidence            44444444444444


No 36 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=28.50  E-value=67  Score=33.86  Aligned_cols=55  Identities=35%  Similarity=0.738  Sum_probs=33.3

Q ss_pred             ccccCCCCcccccCCCCCCCCCCCCCCcccccCCCC--CCccCCCCCcccCcCCCCCCCCCCCCCCCCccccCCCC
Q 024171           41 TRRSFSQGNLCNNCKRPGHFARECPNVAVCNNCGLP--GHIASECTTQARCWNCREPGHMASNCHNEGICHSCGKT  114 (271)
Q Consensus        41 ~~~~~~~~~~C~nCg~~GH~~~~Cp~~~~C~~Cg~~--GH~~~~Cp~~~~C~~Cg~~GH~~~~Cp~~~~C~~Cg~~  114 (271)
                      +|++++..+.|..||-.          ..|-+|...  =|...   ....|..|+....+...||+      ||+.
T Consensus       428 nRRGys~~l~C~~Cg~v----------~~Cp~Cd~~lt~H~~~---~~L~CH~Cg~~~~~p~~Cp~------Cgs~  484 (730)
T COG1198         428 NRRGYAPLLLCRDCGYI----------AECPNCDSPLTLHKAT---GQLRCHYCGYQEPIPQSCPE------CGSE  484 (730)
T ss_pred             ccCCccceeecccCCCc----------ccCCCCCcceEEecCC---CeeEeCCCCCCCCCCCCCCC------CCCC
Confidence            56888888999999633          345555432  24433   23577777766555554443      6665


No 37 
>KOG2548 consensus SWAP mRNA splicing regulator [RNA processing and modification]
Probab=27.21  E-value=29  Score=35.03  Aligned_cols=12  Identities=83%  Similarity=0.833  Sum_probs=4.9

Q ss_pred             cccccccccCCC
Q 024171            5 SRSISRSRSRSR   16 (271)
Q Consensus         5 ~~~~~~~~~~~~   16 (271)
                      ++|.||++|||+
T Consensus       388 srssSrsssRSr  399 (653)
T KOG2548|consen  388 SRSSSRSSSRSR  399 (653)
T ss_pred             cccccccccccc
Confidence            344444444333


No 38 
>KOG3116 consensus Predicted C3H1-type Zn-finger protein [General function prediction only]
Probab=26.90  E-value=18  Score=30.59  Aligned_cols=19  Identities=32%  Similarity=0.807  Sum_probs=15.3

Q ss_pred             CccccccCCCCCcCCCCCC
Q 024171          222 DVICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       222 ~~~C~~C~~~gH~~~dCp~  240 (271)
                      .+.|-+|.+.|||..+|.+
T Consensus        27 ~~rCQKClq~GHWtYECk~   45 (177)
T KOG3116|consen   27 SARCQKCLQAGHWTYECKN   45 (177)
T ss_pred             chhHHHHHhhccceeeecC
Confidence            4678888888888888875


No 39 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=24.00  E-value=40  Score=27.56  Aligned_cols=19  Identities=32%  Similarity=0.656  Sum_probs=16.4

Q ss_pred             cCccccccCCCCCcCCCCCC
Q 024171          221 HDVICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       221 ~~~~C~~C~~~gH~~~dCp~  240 (271)
                      ..++|..|+ -.||...||-
T Consensus       105 ~~v~CR~Ck-GdH~T~~CPy  123 (128)
T PF12353_consen  105 SKVKCRICK-GDHWTSKCPY  123 (128)
T ss_pred             ceEEeCCCC-CCcccccCCc
Confidence            468999996 7799999994


No 40 
>KOG2673 consensus Uncharacterized conserved protein, contains PSP domain [Function unknown]
Probab=23.51  E-value=31  Score=34.19  Aligned_cols=22  Identities=41%  Similarity=0.795  Sum_probs=16.1

Q ss_pred             eEcCCCCCcCCCCCCCCCcCCC
Q 024171          245 CRNCGGRGHMAYECPSGRIADR  266 (271)
Q Consensus       245 C~~Cg~~GH~~~~Cp~~~~~~~  266 (271)
                      ||||+..-|--+|||.+...-+
T Consensus       131 CFNC~g~~hsLrdC~rp~d~s~  152 (485)
T KOG2673|consen  131 CFNCGGTPHSLRDCPRPFDFSR  152 (485)
T ss_pred             ccccCCCCCccccCCCccccHH
Confidence            7888888887888887765543


No 41 
>KOG4246 consensus Predicted DNA-binding protein, contains SAP domain [General function prediction only]
Probab=23.35  E-value=33  Score=36.56  Aligned_cols=21  Identities=29%  Similarity=0.265  Sum_probs=9.9

Q ss_pred             hhhcccccCCCCCcchhcccc
Q 024171           24 RFRSRHSSYCDPPLRRETRRS   44 (271)
Q Consensus        24 ~~~~~~~~~~~~~~~r~~~~~   44 (271)
                      ++++-|.+.|.-|+-+..++.
T Consensus       353 rer~prRr~R~~pRy~~r~~k  373 (1194)
T KOG4246|consen  353 RERIPRRRERQGPRYRERKRK  373 (1194)
T ss_pred             hhcchHhhhhccchHHHhhhc
Confidence            333335555555555544443


No 42 
>PF12353 eIF3g:  Eukaryotic translation initiation factor 3 subunit G ;  InterPro: IPR024675 At least eleven different protein factors are involved in initiation of protein synthesis in eukaryotes. Binding of initiator tRNA and mRNA to the 40S subunit requires the presence of the translation initiation factors eIF-2 and eIF-3, with eIF-3 being particularly important for 80S ribosome dissociation and mRNA binding []. eIF-3 is the most complex translation inititation factor, consisting of about 13 putative subunits and having a molecular weight of between 550 - 700 kDa in mammalian cells. Subunits are designated eIF-3a - eIF-3m; the large number of subunits means that the interactions between the individual subunits that make up the eIF-3 complex are complex and varied. Subunit G is required for eIF3 integrity.   This entry represents a domain of approximately 130 amino acids in length found at the N terminus of eukaryotic translation initiation factor 3 subunit G. This domain is commonly found in association with the RNA recognition domain PF00076 from PFAM. 
Probab=23.08  E-value=52  Score=26.88  Aligned_cols=22  Identities=27%  Similarity=0.641  Sum_probs=18.7

Q ss_pred             CCcceEcCCCCCcCCCCCCCCCc
Q 024171          241 PLIICRNCGGRGHMAYECPSGRI  263 (271)
Q Consensus       241 ~~~~C~~Cg~~GH~~~~Cp~~~~  263 (271)
                      ..+.|..|+ -.||...||....
T Consensus       105 ~~v~CR~Ck-GdH~T~~CPyKd~  126 (128)
T PF12353_consen  105 SKVKCRICK-GDHWTSKCPYKDT  126 (128)
T ss_pred             ceEEeCCCC-CCcccccCCcccc
Confidence            569999996 7799999998654


No 43 
>KOG3973 consensus Uncharacterized conserved glycine-rich protein [Function unknown]
Probab=22.14  E-value=85  Score=30.29  Aligned_cols=20  Identities=60%  Similarity=1.151  Sum_probs=9.1

Q ss_pred             CCCCCCCCCCCCCCCCCCcc
Q 024171          201 ERGGGGGGDGGGGGGRYVGY  220 (271)
Q Consensus       201 ~~~~~~g~~~~~~~~~~~~~  220 (271)
                      .+++++|+.||++.++++++
T Consensus       365 ~~gGrGgGRGggG~GGGggy  384 (465)
T KOG3973|consen  365 NWGGRGGGRGGGGRGGGGGY  384 (465)
T ss_pred             CCCCCCCCCCCCCCCCCCCC
Confidence            44555555554333333333


No 44 
>PF00684 DnaJ_CXXCXGXG:  DnaJ central domain;  InterPro: IPR001305 The hsp70 chaperone machine performs many diverse roles in the cell, including folding of nascent proteins, translocation of polypeptides across organelle membranes, coordinating responses to stress, and targeting selected proteins for degradation. DnaJ is a member of the hsp40 family of molecular chaperones, which is also called the J-protein family, the members of which regulate the activity of hsp70s. DnaJ (hsp40) binds to DnaK (hsp70) and stimulates its ATPase activity, generating the ADP-bound state of DnaK, which interacts stably with the polypeptide substrate []. Besides stimulating the ATPase activity of DnaK through its J-domain, DnaJ also associates with unfolded polypeptide chains and prevents their aggregation []. DnaJ consists of an N-terminal conserved domain (called 'J' domain) of about 70 amino acid residues, a glycine and phenylalanine-rich domain ('G/F' domain), a central cysteine rich domain (CR-type zinc finger) containing four repeats of a CXXCXGXG motif which can coordinate two zinc atom and a C-terminal domain (CTD) []. This entry represents the central cysteine-rich (CR) domain of DnaJ proteins. This central cysteine rich domain (CR-type zinc finger) has an overall V-shaped extended beta-hairpin topology and contains four repeats of the motif CXXCXGXG where X is any amino acid. The isolated cysteine rich domain folds in zinc dependent fashion. Each set of two repeats binds one unit of zinc. Although this domain has been implicated in substrate binding, no evidence of specific interaction between the isolated DnaJ cysteine rich domain and various hydrophobic peptides has been found [].; GO: 0031072 heat shock protein binding, 0051082 unfolded protein binding; PDB: 1NLT_A 2CTT_A 1EXK_A.
Probab=20.95  E-value=45  Score=23.71  Aligned_cols=11  Identities=45%  Similarity=1.072  Sum_probs=5.5

Q ss_pred             cccccCCCCcc
Q 024171          152 ACKNCRKTGHI  162 (271)
Q Consensus       152 ~C~~Cg~~GH~  162 (271)
                      .|..|...|.+
T Consensus        43 ~C~~C~G~G~~   53 (66)
T PF00684_consen   43 TCPKCGGTGKI   53 (66)
T ss_dssp             E-TTTSSSSEE
T ss_pred             ECCCCcceeeE
Confidence            45555555554


No 45 
>KOG2044 consensus 5'-3' exonuclease HKE1/RAT1 [Replication, recombination and repair; RNA processing and modification]
Probab=20.59  E-value=42  Score=35.55  Aligned_cols=19  Identities=42%  Similarity=0.884  Sum_probs=13.1

Q ss_pred             CccccccCCCCCcCCCCCC
Q 024171          222 DVICRSCNQMGHMSRDCVG  240 (271)
Q Consensus       222 ~~~C~~C~~~gH~~~dCp~  240 (271)
                      +..|+.||++||.+.||..
T Consensus       260 ~~~C~~cgq~gh~~~dc~g  278 (931)
T KOG2044|consen  260 PRRCFLCGQTGHEAKDCEG  278 (931)
T ss_pred             cccchhhcccCCcHhhcCC
Confidence            4557777777777777764


No 46 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=20.42  E-value=99  Score=22.03  Aligned_cols=10  Identities=20%  Similarity=0.527  Sum_probs=5.4

Q ss_pred             CcccccCCCC
Q 024171           48 GNLCNNCKRP   57 (271)
Q Consensus        48 ~~~C~nCg~~   57 (271)
                      +.+|..|+..
T Consensus         7 ~~~CtSCg~~   16 (59)
T PRK14890          7 PPKCTSCGIE   16 (59)
T ss_pred             CccccCCCCc
Confidence            3456666544


Done!