Citrus Sinensis ID: 024238

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270

MDQSDQTQQQQQQQQQPVMGVVAGAGQMSYPPYHTAPLVASGTPAVAVPSPTQPPSTFASSPHQLAYQQAQHFHHQQQQQQQQQLQMFWSNQMQEIEQTADFKNHSLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRSWIHTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGVTKGALPVVGSPGDMPLYYVPPQHPVGHTGMIMGKPVDQAALYSGQQPRPPVAFMPWPQSQSQAQQQQQPQQQQNDP

ccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHcccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccc

*****************************************************************************************************F*NHSLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRSWIHTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELK******************DMPLYYVPPQHPVGHTGMIMG*******************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Nuclear transcription factor Y subunit C-9	Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.	probable	Q8L4B2

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G92, chain C
Confidence level:very confident
Coverage over the Query: 71-183
View the alignment between query and template
View the model in PyMOL

Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 44-55
View the alignment between query and template
View the model in PyMOL