Citrus Sinensis ID: 024282
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 269 | ||||||
| 224069028 | 269 | predicted protein [Populus trichocarpa] | 1.0 | 1.0 | 0.814 | 1e-128 | |
| 255557907 | 358 | methylenetetrahydrofolate dehydrogenase, | 0.996 | 0.748 | 0.794 | 1e-126 | |
| 449525075 | 357 | PREDICTED: bifunctional protein FolD-lik | 1.0 | 0.753 | 0.799 | 1e-125 | |
| 449459574 | 357 | PREDICTED: bifunctional protein FolD-lik | 1.0 | 0.753 | 0.795 | 1e-125 | |
| 296085803 | 358 | unnamed protein product [Vitis vinifera] | 1.0 | 0.751 | 0.802 | 1e-125 | |
| 225439037 | 355 | PREDICTED: bifunctional protein FolD-lik | 1.0 | 0.757 | 0.802 | 1e-125 | |
| 147770970 | 362 | hypothetical protein VITISV_024214 [Viti | 1.0 | 0.743 | 0.782 | 1e-123 | |
| 356505416 | 361 | PREDICTED: bifunctional protein FolD-lik | 1.0 | 0.745 | 0.791 | 1e-123 | |
| 297823751 | 350 | methylenetetrahydrofolate dehydrogenase | 0.988 | 0.76 | 0.778 | 1e-121 | |
| 357438639 | 309 | Bifunctional protein folD [Medicago trun | 1.0 | 0.870 | 0.784 | 1e-121 |
| >gi|224069028|ref|XP_002326257.1| predicted protein [Populus trichocarpa] gi|222833450|gb|EEE71927.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 462 bits (1190), Expect = e-128, Method: Compositional matrix adjust.
Identities = 219/269 (81%), Positives = 245/269 (91%)
Query: 1 MKKSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSN 60
MK S+GK+PGLAVILVG+RRDS TYVRNK+KACE+ GIKS+VT+F C +D+V++ALS
Sbjct: 1 MKDSVGKIPGLAVILVGDRRDSLTYVRNKVKACEDAGIKSLVTQFPQDCKQDDVIHALSA 60
Query: 61 YNQDSSINGILVQLPLPQHLDEGKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTP 120
+N+D SI+GILVQLPLPQHLDEGKIL+ + LEKDVDGFHPLN+GNLAMRGREPLFIPCTP
Sbjct: 61 FNEDPSIHGILVQLPLPQHLDEGKILNVLKLEKDVDGFHPLNMGNLAMRGREPLFIPCTP 120
Query: 121 KGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEA 180
KGCIELLIRS VEIMGKNAVVIGRSNIVGLP SLLLQRHHATV+IVHA TKNPEQI EA
Sbjct: 121 KGCIELLIRSSVEIMGKNAVVIGRSNIVGLPISLLLQRHHATVTIVHAFTKNPEQIAREA 180
Query: 181 DIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVIT 240
DIV+ A GV NLVRG+WLKPGAVV+DVGT PV+DPSCE GYRL+GDVCYEEA ++AS IT
Sbjct: 181 DIVVTATGVPNLVRGNWLKPGAVVIDVGTFPVEDPSCENGYRLIGDVCYEEASKVASAIT 240
Query: 241 PVPGGVGPMTVAMLLSNTLDSAKRAYGFT 269
PVPGGVGPMT+AMLLSNTLDSAKRAY FT
Sbjct: 241 PVPGGVGPMTIAMLLSNTLDSAKRAYDFT 269
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255557907|ref|XP_002519982.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] gi|223540746|gb|EEF42306.1| methylenetetrahydrofolate dehydrogenase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|449525075|ref|XP_004169545.1| PREDICTED: bifunctional protein FolD-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449459574|ref|XP_004147521.1| PREDICTED: bifunctional protein FolD-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|296085803|emb|CBI31127.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|225439037|ref|XP_002264477.1| PREDICTED: bifunctional protein FolD-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|147770970|emb|CAN65246.1| hypothetical protein VITISV_024214 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356505416|ref|XP_003521487.1| PREDICTED: bifunctional protein FolD-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|297823751|ref|XP_002879758.1| methylenetetrahydrofolate dehydrogenase [Arabidopsis lyrata subsp. lyrata] gi|297325597|gb|EFH56017.1| methylenetetrahydrofolate dehydrogenase [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|357438639|ref|XP_003589595.1| Bifunctional protein folD [Medicago truncatula] gi|355478643|gb|AES59846.1| Bifunctional protein folD [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 269 | ||||||
| TAIR|locus:2064143 | 352 | AT2G38660 [Arabidopsis thalian | 0.988 | 0.755 | 0.766 | 2.6e-111 | |
| TAIR|locus:2127113 | 360 | EMB3127 "EMBRYO DEFECTIVE 3127 | 0.996 | 0.744 | 0.708 | 5.4e-102 | |
| TAIR|locus:2082254 | 299 | AT3G12290 [Arabidopsis thalian | 0.973 | 0.876 | 0.633 | 1.4e-87 | |
| TAIR|locus:2127083 | 310 | AT4G00600 [Arabidopsis thalian | 0.944 | 0.819 | 0.616 | 6.6e-81 | |
| DICTYBASE|DDB_G0283121 | 292 | DDB_G0283121 "methenyl tetrahy | 0.959 | 0.883 | 0.553 | 9.9e-71 | |
| ASPGD|ASPL0000036964 | 1031 | AN2998 [Emericella nidulans (t | 0.955 | 0.249 | 0.546 | 7.5e-67 | |
| SGD|S000000288 | 975 | MIS1 "Mitochondrial C1-tetrahy | 0.959 | 0.264 | 0.519 | 1.5e-65 | |
| FB|FBgn0020385 | 968 | pug "pugilist" [Drosophila mel | 0.977 | 0.271 | 0.509 | 1.7e-65 | |
| CGD|CAL0000024 | 1025 | MIS12 [Candida albicans (taxid | 0.944 | 0.247 | 0.484 | 1.5e-63 | |
| UNIPROTKB|Q5AAF6 | 1025 | MIS1 "Putative uncharacterized | 0.944 | 0.247 | 0.484 | 1.5e-63 |
| TAIR|locus:2064143 AT2G38660 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1099 (391.9 bits), Expect = 2.6e-111, P = 2.6e-111
Identities = 204/266 (76%), Positives = 238/266 (89%)
Query: 1 MKKSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSN 60
MKK++GKVPGLAV+LVGE+RDSQTYVRNKIKACEE GIKS++ E + CTE ++++ L
Sbjct: 86 MKKAVGKVPGLAVVLVGEQRDSQTYVRNKIKACEETGIKSVLAELPEDCTEGQIISVLRK 145
Query: 61 YNQDSSINGILVQLPLPQHLDEGKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTP 120
+N+D+SI+GILVQLPLPQHL+E KIL+ V LEKDVDGFHPLN+GNLAMRGREPLF+ CTP
Sbjct: 146 FNEDTSIHGILVQLPLPQHLNESKILNMVRLEKDVDGFHPLNVGNLAMRGREPLFVSCTP 205
Query: 121 KGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEA 180
KGC+ELLIR+GVEI GKNAVVIGRSNIVGLP SLLLQRH ATVS VHA TK+PE IT +A
Sbjct: 206 KGCVELLIRTGVEIAGKNAVVIGRSNIVGLPMSLLLQRHDATVSTVHAFTKDPEHITRKA 265
Query: 181 DIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVIT 240
DIVIAAAG+ NLVRGSWLKPGAVV+DVGT PV+D SCE+GYRL+GDVCYEEA+ +AS IT
Sbjct: 266 DIVIAAAGIPNLVRGSWLKPGAVVIDVGTTPVEDSSCEFGYRLVGDVCYEEALGVASAIT 325
Query: 241 PVPGGVGPMTVAMLLSNTLDSAKRAY 266
PVPGGVGPMT+ MLL NTL++AKR +
Sbjct: 326 PVPGGVGPMTITMLLCNTLEAAKRIF 351
|
|
| TAIR|locus:2127113 EMB3127 "EMBRYO DEFECTIVE 3127" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2082254 AT3G12290 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2127083 AT4G00600 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0283121 DDB_G0283121 "methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene H4F dehydrogenase" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000036964 AN2998 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| SGD|S000000288 MIS1 "Mitochondrial C1-tetrahydrofolate synthase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0020385 pug "pugilist" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000024 MIS12 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5AAF6 MIS1 "Putative uncharacterized protein MIS1" [Candida albicans SC5314 (taxid:237561)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 269 | |||
| PLN02897 | 345 | PLN02897, PLN02897, tetrahydrofolate dehydrogenase | 1e-180 | |
| PLN02616 | 364 | PLN02616, PLN02616, tetrahydrofolate dehydrogenase | 1e-147 | |
| PLN02516 | 299 | PLN02516, PLN02516, methylenetetrahydrofolate dehy | 1e-132 | |
| COG0190 | 283 | COG0190, FolD, 5,10-methylene-tetrahydrofolate deh | 1e-115 | |
| PRK14190 | 284 | PRK14190, PRK14190, bifunctional 5,10-methylene-te | 1e-108 | |
| PRK10792 | 285 | PRK10792, PRK10792, bifunctional 5,10-methylene-te | 1e-104 | |
| PRK14189 | 285 | PRK14189, PRK14189, bifunctional 5,10-methylene-te | 1e-101 | |
| PRK14188 | 296 | PRK14188, PRK14188, bifunctional 5,10-methylene-te | 1e-101 | |
| PRK14174 | 295 | PRK14174, PRK14174, bifunctional 5,10-methylene-te | 1e-100 | |
| PRK14191 | 285 | PRK14191, PRK14191, bifunctional 5,10-methylene-te | 1e-100 | |
| PRK14186 | 297 | PRK14186, PRK14186, bifunctional 5,10-methylene-te | 3e-98 | |
| PRK14179 | 284 | PRK14179, PRK14179, bifunctional 5,10-methylene-te | 4e-96 | |
| PRK14185 | 293 | PRK14185, PRK14185, bifunctional 5,10-methylene-te | 4e-92 | |
| PRK14168 | 297 | PRK14168, PRK14168, bifunctional 5,10-methylene-te | 3e-91 | |
| PRK14170 | 284 | PRK14170, PRK14170, bifunctional 5,10-methylene-te | 4e-89 | |
| PRK14194 | 301 | PRK14194, PRK14194, bifunctional 5,10-methylene-te | 6e-87 | |
| PRK14183 | 281 | PRK14183, PRK14183, bifunctional 5,10-methylene-te | 1e-86 | |
| PRK14193 | 284 | PRK14193, PRK14193, bifunctional 5,10-methylene-te | 1e-84 | |
| cd01080 | 168 | cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding | 1e-84 | |
| PRK14184 | 286 | PRK14184, PRK14184, bifunctional 5,10-methylene-te | 2e-84 | |
| PRK14167 | 297 | PRK14167, PRK14167, bifunctional 5,10-methylene-te | 5e-84 | |
| PRK14176 | 287 | PRK14176, PRK14176, bifunctional 5,10-methylene-te | 3e-83 | |
| pfam02882 | 160 | pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro | 3e-83 | |
| PRK14175 | 286 | PRK14175, PRK14175, bifunctional 5,10-methylene-te | 5e-83 | |
| PRK14166 | 282 | PRK14166, PRK14166, bifunctional 5,10-methylene-te | 3e-82 | |
| PRK14187 | 294 | PRK14187, PRK14187, bifunctional 5,10-methylene-te | 5e-82 | |
| PRK14178 | 279 | PRK14178, PRK14178, bifunctional 5,10-methylene-te | 6e-79 | |
| PRK14182 | 282 | PRK14182, PRK14182, bifunctional 5,10-methylene-te | 4e-77 | |
| PRK14172 | 278 | PRK14172, PRK14172, bifunctional 5,10-methylene-te | 1e-75 | |
| PRK14173 | 287 | PRK14173, PRK14173, bifunctional 5,10-methylene-te | 3e-75 | |
| PRK14181 | 287 | PRK14181, PRK14181, bifunctional 5,10-methylene-te | 5e-74 | |
| PRK14169 | 282 | PRK14169, PRK14169, bifunctional 5,10-methylene-te | 2e-72 | |
| PRK14192 | 283 | PRK14192, PRK14192, bifunctional 5,10-methylene-te | 8e-72 | |
| PRK14171 | 288 | PRK14171, PRK14171, bifunctional 5,10-methylene-te | 3e-71 | |
| PRK14180 | 282 | PRK14180, PRK14180, bifunctional 5,10-methylene-te | 2e-68 | |
| PRK14177 | 284 | PRK14177, PRK14177, bifunctional 5,10-methylene-te | 1e-66 | |
| pfam00763 | 117 | pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydroge | 7e-41 | |
| cd05212 | 140 | cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b | 2e-28 | |
| cd01079 | 197 | cd01079, NAD_bind_m-THF_DH, NAD binding domain of | 1e-14 |
| >gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
Score = 499 bits (1286), Expect = e-180
Identities = 209/266 (78%), Positives = 240/266 (90%)
Query: 1 MKKSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSN 60
MKK++GKVPGLAV+LVG++RDSQTYVRNKIKACEE GIKS++ E + CTE ++L+AL
Sbjct: 79 MKKAVGKVPGLAVVLVGQQRDSQTYVRNKIKACEETGIKSLLAELPEDCTEGQILSALRK 138
Query: 61 YNQDSSINGILVQLPLPQHLDEGKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTP 120
+N+D+SI+GILVQLPLPQHLDE KIL+ V LEKDVDGFHPLN+GNLAMRGREPLF+ CTP
Sbjct: 139 FNEDTSIHGILVQLPLPQHLDESKILNMVRLEKDVDGFHPLNVGNLAMRGREPLFVSCTP 198
Query: 121 KGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQITSEA 180
KGC+ELLIRSGVEI GKNAVVIGRSNIVGLP SLLLQRH ATVS VHA TK+PEQIT +A
Sbjct: 199 KGCVELLIRSGVEIAGKNAVVIGRSNIVGLPMSLLLQRHDATVSTVHAFTKDPEQITRKA 258
Query: 181 DIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVIT 240
DIVIAAAG+ NLVRGSWLKPGAVV+DVGT PV+D SCE+GYRL+GDVCYEEA+ +AS IT
Sbjct: 259 DIVIAAAGIPNLVRGSWLKPGAVVIDVGTTPVEDSSCEFGYRLVGDVCYEEALGVASAIT 318
Query: 241 PVPGGVGPMTVAMLLSNTLDSAKRAY 266
PVPGGVGPMT+ MLL NTLD+AKR +
Sbjct: 319 PVPGGVGPMTITMLLCNTLDAAKRIF 344
|
Length = 345 |
| >gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|201431 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|133447 cd01079, NAD_bind_m-THF_DH, NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| COG0190 | 283 | FolD 5,10-methylene-tetrahydrofolate dehydrogenase | 100.0 | |
| PLN02897 | 345 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| PLN02616 | 364 | tetrahydrofolate dehydrogenase/cyclohydrolase, put | 100.0 | |
| PRK14171 | 288 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14168 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PLN02516 | 299 | methylenetetrahydrofolate dehydrogenase (NADP+) | 100.0 | |
| PRK14170 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14185 | 293 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14187 | 294 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14166 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14169 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14182 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14180 | 282 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14181 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14167 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14184 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14190 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14172 | 278 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14186 | 297 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14177 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14183 | 281 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14189 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14193 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14176 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14173 | 287 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK10792 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14191 | 285 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14174 | 295 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14179 | 284 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14175 | 286 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14178 | 279 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14194 | 301 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| PRK14188 | 296 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| KOG4230 | 935 | consensus C1-tetrahydrofolate synthase [Coenzyme t | 100.0 | |
| PRK14192 | 283 | bifunctional 5,10-methylene-tetrahydrofolate dehyd | 100.0 | |
| KOG0089 | 309 | consensus Methylenetetrahydrofolate dehydrogenase/ | 100.0 | |
| PF02882 | 160 | THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl | 100.0 | |
| cd01079 | 197 | NAD_bind_m-THF_DH NAD binding domain of methylene- | 100.0 | |
| cd01080 | 168 | NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of | 100.0 | |
| cd05212 | 140 | NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom | 100.0 | |
| PRK12549 | 284 | shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| PRK12749 | 288 | quinate/shikimate dehydrogenase; Reviewed | 100.0 | |
| PRK12548 | 289 | shikimate 5-dehydrogenase; Provisional | 100.0 | |
| PRK14027 | 283 | quinate/shikimate dehydrogenase; Provisional | 100.0 | |
| COG0169 | 283 | AroE Shikimate 5-dehydrogenase [Amino acid transpo | 100.0 | |
| TIGR01809 | 282 | Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO | 100.0 | |
| PRK12550 | 272 | shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| PRK00258 | 278 | aroE shikimate 5-dehydrogenase; Reviewed | 100.0 | |
| TIGR00507 | 270 | aroE shikimate 5-dehydrogenase. This model finds p | 99.97 | |
| PLN02520 | 529 | bifunctional 3-dehydroquinate dehydratase/shikimat | 99.96 | |
| PRK09310 | 477 | aroDE bifunctional 3-dehydroquinate dehydratase/sh | 99.96 | |
| PF00763 | 117 | THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh | 99.93 | |
| PRK08306 | 296 | dipicolinate synthase subunit A; Reviewed | 99.61 | |
| TIGR02853 | 287 | spore_dpaA dipicolinic acid synthetase, A subunit. | 99.57 | |
| cd01065 | 155 | NAD_bind_Shikimate_DH NAD(P) binding domain of Shi | 99.51 | |
| PF01488 | 135 | Shikimate_DH: Shikimate / quinate 5-dehydrogenase; | 99.4 | |
| COG0373 | 414 | HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | 99.26 | |
| cd05311 | 226 | NAD_bind_2_malic_enz NAD(P) binding domain of mali | 99.18 | |
| PRK13940 | 414 | glutamyl-tRNA reductase; Provisional | 99.16 | |
| cd05191 | 86 | NAD_bind_amino_acid_DH NAD(P) binding domain of am | 99.16 | |
| cd01078 | 194 | NAD_bind_H4MPT_DH NADP binding domain of methylene | 99.1 | |
| PF00670 | 162 | AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase | 99.06 | |
| PRK14982 | 340 | acyl-ACP reductase; Provisional | 98.99 | |
| PF08501 | 83 | Shikimate_dh_N: Shikimate dehydrogenase substrate | 98.95 | |
| PTZ00075 | 476 | Adenosylhomocysteinase; Provisional | 98.91 | |
| PRK00676 | 338 | hemA glutamyl-tRNA reductase; Validated | 98.88 | |
| PLN00203 | 519 | glutamyl-tRNA reductase | 98.78 | |
| PRK00045 | 423 | hemA glutamyl-tRNA reductase; Reviewed | 98.71 | |
| TIGR01035 | 417 | hemA glutamyl-tRNA reductase. This enzyme, togethe | 98.66 | |
| PRK05476 | 425 | S-adenosyl-L-homocysteine hydrolase; Provisional | 98.6 | |
| TIGR00936 | 406 | ahcY adenosylhomocysteinase. This enzyme hydrolyze | 98.51 | |
| cd05213 | 311 | NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain | 98.5 | |
| COG0499 | 420 | SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me | 98.5 | |
| COG5322 | 351 | Predicted dehydrogenase [General function predicti | 98.48 | |
| PLN02928 | 347 | oxidoreductase family protein | 98.45 | |
| TIGR00518 | 370 | alaDH alanine dehydrogenase. The family of known L | 98.38 | |
| TIGR02992 | 326 | ectoine_eutC ectoine utilization protein EutC. Mem | 98.34 | |
| cd00401 | 413 | AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado | 98.34 | |
| PF02826 | 178 | 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy | 98.33 | |
| PLN02494 | 477 | adenosylhomocysteinase | 98.32 | |
| PRK00257 | 381 | erythronate-4-phosphate dehydrogenase; Validated | 98.28 | |
| PRK15438 | 378 | erythronate-4-phosphate dehydrogenase PdxB; Provis | 98.28 | |
| PRK08291 | 330 | ectoine utilization protein EutC; Validated | 98.19 | |
| PRK13243 | 333 | glyoxylate reductase; Reviewed | 98.19 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 98.18 | |
| TIGR00561 | 511 | pntA NAD(P) transhydrogenase, alpha subunit. In so | 98.13 | |
| cd01075 | 200 | NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l | 98.12 | |
| PRK07574 | 385 | formate dehydrogenase; Provisional | 98.06 | |
| PRK06718 | 202 | precorrin-2 dehydrogenase; Reviewed | 98.02 | |
| PRK08618 | 325 | ornithine cyclodeaminase; Validated | 97.97 | |
| PRK15409 | 323 | bifunctional glyoxylate/hydroxypyruvate reductase | 97.97 | |
| COG0281 | 432 | SfcA Malic enzyme [Energy production and conversio | 97.96 | |
| PRK06932 | 314 | glycerate dehydrogenase; Provisional | 97.94 | |
| PRK06436 | 303 | glycerate dehydrogenase; Provisional | 97.93 | |
| PRK06487 | 317 | glycerate dehydrogenase; Provisional | 97.9 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 97.9 | |
| PRK06141 | 314 | ornithine cyclodeaminase; Validated | 97.9 | |
| PRK08410 | 311 | 2-hydroxyacid dehydrogenase; Provisional | 97.9 | |
| PLN03139 | 386 | formate dehydrogenase; Provisional | 97.89 | |
| PRK07232 | 752 | bifunctional malic enzyme oxidoreductase/phosphotr | 97.87 | |
| PRK12862 | 763 | malic enzyme; Reviewed | 97.87 | |
| KOG1370 | 434 | consensus S-adenosylhomocysteine hydrolase [Coenzy | 97.86 | |
| PRK08605 | 332 | D-lactate dehydrogenase; Validated | 97.86 | |
| PRK07340 | 304 | ornithine cyclodeaminase; Validated | 97.84 | |
| PRK15469 | 312 | ghrA bifunctional glyoxylate/hydroxypyruvate reduc | 97.84 | |
| PF01262 | 168 | AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal | 97.83 | |
| PRK12480 | 330 | D-lactate dehydrogenase; Provisional | 97.81 | |
| PLN02306 | 386 | hydroxypyruvate reductase | 97.77 | |
| PF03446 | 163 | NAD_binding_2: NAD binding domain of 6-phosphogluc | 97.76 | |
| COG0111 | 324 | SerA Phosphoglycerate dehydrogenase and related de | 97.75 | |
| PRK12861 | 764 | malic enzyme; Reviewed | 97.71 | |
| PF13241 | 103 | NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ | 97.69 | |
| PRK11790 | 409 | D-3-phosphoglycerate dehydrogenase; Provisional | 97.64 | |
| TIGR01327 | 525 | PGDH D-3-phosphoglycerate dehydrogenase. This mode | 97.62 | |
| PRK13581 | 526 | D-3-phosphoglycerate dehydrogenase; Provisional | 97.58 | |
| COG1748 | 389 | LYS9 Saccharopine dehydrogenase and related protei | 97.58 | |
| PRK06719 | 157 | precorrin-2 dehydrogenase; Validated | 97.53 | |
| COG1052 | 324 | LdhA Lactate dehydrogenase and related dehydrogena | 97.5 | |
| COG2084 | 286 | MmsB 3-hydroxyisobutyrate dehydrogenase and relate | 97.46 | |
| PRK14619 | 308 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 97.44 | |
| PF01210 | 157 | NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate | 97.4 | |
| PRK11199 | 374 | tyrA bifunctional chorismate mutase/prephenate deh | 97.38 | |
| KOG0069 | 336 | consensus Glyoxylate/hydroxypyruvate reductase (D- | 97.36 | |
| PRK06823 | 315 | ornithine cyclodeaminase; Validated | 97.36 | |
| TIGR02371 | 325 | ala_DH_arch alanine dehydrogenase, Archaeoglobus f | 97.35 | |
| PF03807 | 96 | F420_oxidored: NADP oxidoreductase coenzyme F420-d | 97.31 | |
| PRK06407 | 301 | ornithine cyclodeaminase; Provisional | 97.31 | |
| cd05312 | 279 | NAD_bind_1_malic_enz NAD(P) binding domain of mali | 97.28 | |
| PF02423 | 313 | OCD_Mu_crystall: Ornithine cyclodeaminase/mu-cryst | 97.24 | |
| TIGR01470 | 205 | cysG_Nterm siroheme synthase, N-terminal domain. T | 97.23 | |
| cd00762 | 254 | NAD_bind_malic_enz NAD(P) binding domain of malic | 97.21 | |
| PRK06046 | 326 | alanine dehydrogenase; Validated | 97.21 | |
| PF03949 | 255 | Malic_M: Malic enzyme, NAD binding domain; InterPr | 97.21 | |
| PRK14804 | 311 | ornithine carbamoyltransferase; Provisional | 97.15 | |
| PRK13814 | 310 | pyrB aspartate carbamoyltransferase catalytic subu | 97.14 | |
| PRK07589 | 346 | ornithine cyclodeaminase; Validated | 97.13 | |
| COG0287 | 279 | TyrA Prephenate dehydrogenase [Amino acid transpor | 97.11 | |
| PF07991 | 165 | IlvN: Acetohydroxy acid isomeroreductase, catalyti | 97.09 | |
| COG2085 | 211 | Predicted dinucleotide-binding enzymes [General fu | 97.09 | |
| TIGR01505 | 291 | tartro_sem_red 2-hydroxy-3-oxopropionate reductase | 97.09 | |
| PLN02712 | 667 | arogenate dehydrogenase | 97.08 | |
| PRK13529 | 563 | malate dehydrogenase; Provisional | 97.06 | |
| PLN02256 | 304 | arogenate dehydrogenase | 97.06 | |
| PRK01438 | 480 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 97.05 | |
| PRK11559 | 296 | garR tartronate semialdehyde reductase; Provisiona | 97.03 | |
| PRK01713 | 334 | ornithine carbamoyltransferase; Provisional | 97.02 | |
| PRK04284 | 332 | ornithine carbamoyltransferase; Provisional | 97.01 | |
| PRK03515 | 336 | ornithine carbamoyltransferase subunit I; Provisio | 97.0 | |
| COG1648 | 210 | CysG Siroheme synthase (precorrin-2 oxidase/ferroc | 96.97 | |
| PRK15461 | 296 | NADH-dependent gamma-hydroxybutyrate dehydrogenase | 96.96 | |
| TIGR00670 | 301 | asp_carb_tr aspartate carbamoyltransferase. Ornith | 96.95 | |
| PRK05579 | 399 | bifunctional phosphopantothenoylcysteine decarboxy | 96.95 | |
| PRK00856 | 305 | pyrB aspartate carbamoyltransferase catalytic subu | 96.92 | |
| PLN03129 | 581 | NADP-dependent malic enzyme; Provisional | 96.89 | |
| PRK07502 | 307 | cyclohexadienyl dehydrogenase; Validated | 96.88 | |
| PRK02102 | 331 | ornithine carbamoyltransferase; Validated | 96.88 | |
| PRK05562 | 223 | precorrin-2 dehydrogenase; Provisional | 96.87 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 96.85 | |
| PRK12562 | 334 | ornithine carbamoyltransferase subunit F; Provisio | 96.84 | |
| PLN02342 | 348 | ornithine carbamoyltransferase | 96.84 | |
| PRK13403 | 335 | ketol-acid reductoisomerase; Provisional | 96.83 | |
| PRK02255 | 338 | putrescine carbamoyltransferase; Provisional | 96.81 | |
| TIGR00658 | 304 | orni_carb_tr ornithine carbamoyltransferase. Most | 96.79 | |
| PLN02527 | 306 | aspartate carbamoyltransferase | 96.77 | |
| PRK06545 | 359 | prephenate dehydrogenase; Validated | 96.76 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 96.75 | |
| PRK07417 | 279 | arogenate dehydrogenase; Reviewed | 96.75 | |
| PRK14805 | 302 | ornithine carbamoyltransferase; Provisional | 96.72 | |
| KOG2017 | 427 | consensus Molybdopterin synthase sulfurylase [Coen | 96.68 | |
| COG2423 | 330 | Predicted ornithine cyclodeaminase, mu-crystallin | 96.68 | |
| PRK00779 | 304 | ornithine carbamoyltransferase; Provisional | 96.68 | |
| PF13460 | 183 | NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X | 96.67 | |
| PRK08818 | 370 | prephenate dehydrogenase; Provisional | 96.67 | |
| PRK11891 | 429 | aspartate carbamoyltransferase; Provisional | 96.67 | |
| PRK05479 | 330 | ketol-acid reductoisomerase; Provisional | 96.64 | |
| PRK14106 | 450 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.64 | |
| PF01118 | 121 | Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi | 96.64 | |
| PRK08655 | 437 | prephenate dehydrogenase; Provisional | 96.61 | |
| PF02737 | 180 | 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind | 96.6 | |
| TIGR03316 | 357 | ygeW probable carbamoyltransferase YgeW. Members o | 96.59 | |
| PRK11064 | 415 | wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro | 96.57 | |
| TIGR01692 | 288 | HIBADH 3-hydroxyisobutyrate dehydrogenase. This en | 96.57 | |
| PRK09260 | 288 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.54 | |
| PRK06199 | 379 | ornithine cyclodeaminase; Validated | 96.52 | |
| PRK07679 | 279 | pyrroline-5-carboxylate reductase; Reviewed | 96.52 | |
| PRK12490 | 299 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.49 | |
| PRK15059 | 292 | tartronate semialdehyde reductase; Provisional | 96.48 | |
| PRK06398 | 258 | aldose dehydrogenase; Validated | 96.46 | |
| PRK14618 | 328 | NAD(P)H-dependent glycerol-3-phosphate dehydrogena | 96.46 | |
| PRK12491 | 272 | pyrroline-5-carboxylate reductase; Reviewed | 96.42 | |
| PRK08192 | 338 | aspartate carbamoyltransferase; Provisional | 96.42 | |
| PRK08223 | 287 | hypothetical protein; Validated | 96.38 | |
| TIGR02354 | 200 | thiF_fam2 thiamine biosynthesis protein ThiF, fami | 96.38 | |
| PRK06949 | 258 | short chain dehydrogenase; Provisional | 96.36 | |
| PRK06523 | 260 | short chain dehydrogenase; Provisional | 96.35 | |
| PF10727 | 127 | Rossmann-like: Rossmann-like domain; InterPro: IPR | 96.35 | |
| TIGR00465 | 314 | ilvC ketol-acid reductoisomerase. This is the seco | 96.34 | |
| PRK02472 | 447 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.32 | |
| COG0078 | 310 | ArgF Ornithine carbamoyltransferase [Amino acid tr | 96.32 | |
| TIGR02356 | 202 | adenyl_thiF thiazole biosynthesis adenylyltransfer | 96.31 | |
| PRK08293 | 287 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 96.3 | |
| PTZ00317 | 559 | NADP-dependent malic enzyme; Provisional | 96.29 | |
| TIGR02355 | 240 | moeB molybdopterin synthase sulfurylase MoeB. This | 96.25 | |
| PRK12367 | 245 | short chain dehydrogenase; Provisional | 96.23 | |
| PRK09599 | 301 | 6-phosphogluconate dehydrogenase-like protein; Rev | 96.21 | |
| PRK06550 | 235 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 96.21 | |
| TIGR00872 | 298 | gnd_rel 6-phosphogluconate dehydrogenase (decarbox | 96.19 | |
| cd01076 | 227 | NAD_bind_1_Glu_DH NAD(P) binding domain of glutama | 96.16 | |
| PRK08507 | 275 | prephenate dehydrogenase; Validated | 96.16 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 96.15 | |
| cd05211 | 217 | NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of | 96.15 | |
| cd01492 | 197 | Aos1_SUMO Ubiquitin activating enzyme (E1) subunit | 96.15 | |
| cd00757 | 228 | ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 | 96.15 | |
| PRK12475 | 338 | thiamine/molybdopterin biosynthesis MoeB-like prot | 96.13 | |
| PLN02819 | 1042 | lysine-ketoglutarate reductase/saccharopine dehydr | 96.13 | |
| PLN02586 | 360 | probable cinnamyl alcohol dehydrogenase | 96.12 | |
| PLN02688 | 266 | pyrroline-5-carboxylate reductase | 96.12 | |
| PRK09072 | 263 | short chain dehydrogenase; Provisional | 96.11 | |
| PRK00094 | 325 | gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr | 96.11 | |
| PRK07200 | 395 | aspartate/ornithine carbamoyltransferase family pr | 96.08 | |
| PRK05690 | 245 | molybdopterin biosynthesis protein MoeB; Provision | 96.04 | |
| cd05313 | 254 | NAD_bind_2_Glu_DH NAD(P) binding domain of glutama | 96.02 | |
| PRK12828 | 239 | short chain dehydrogenase; Provisional | 96.02 | |
| PRK00141 | 473 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 96.0 | |
| COG2910 | 211 | Putative NADH-flavin reductase [General function p | 96.0 | |
| PLN02712 | 667 | arogenate dehydrogenase | 96.0 | |
| PRK07523 | 255 | gluconate 5-dehydrogenase; Provisional | 95.99 | |
| PRK07424 | 406 | bifunctional sterol desaturase/short chain dehydro | 95.98 | |
| PRK01710 | 458 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.94 | |
| PRK08644 | 212 | thiamine biosynthesis protein ThiF; Provisional | 95.94 | |
| TIGR01832 | 248 | kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod | 95.93 | |
| PRK06171 | 266 | sorbitol-6-phosphate 2-dehydrogenase; Provisional | 95.93 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 95.92 | |
| PRK05866 | 293 | short chain dehydrogenase; Provisional | 95.9 | |
| PRK08862 | 227 | short chain dehydrogenase; Provisional | 95.89 | |
| PRK03369 | 488 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.89 | |
| CHL00194 | 317 | ycf39 Ycf39; Provisional | 95.89 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 95.87 | |
| PRK08762 | 376 | molybdopterin biosynthesis protein MoeB; Validated | 95.86 | |
| PF00899 | 135 | ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a | 95.85 | |
| PRK07231 | 251 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.84 | |
| PRK06130 | 311 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.83 | |
| PRK06124 | 256 | gluconate 5-dehydrogenase; Provisional | 95.82 | |
| PRK00421 | 461 | murC UDP-N-acetylmuramate--L-alanine ligase; Provi | 95.81 | |
| PLN00141 | 251 | Tic62-NAD(P)-related group II protein; Provisional | 95.8 | |
| PRK07819 | 286 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.79 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 95.79 | |
| COG3288 | 356 | PntA NAD/NADP transhydrogenase alpha subunit [Ener | 95.78 | |
| COG0569 | 225 | TrkA K+ transport systems, NAD-binding component [ | 95.78 | |
| KOG1198 | 347 | consensus Zinc-binding oxidoreductase [Energy prod | 95.78 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 95.78 | |
| PF03435 | 386 | Saccharop_dh: Saccharopine dehydrogenase ; InterPr | 95.76 | |
| COG1086 | 588 | Predicted nucleoside-diphosphate sugar epimerases | 95.75 | |
| PRK08085 | 254 | gluconate 5-dehydrogenase; Provisional | 95.75 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 95.74 | |
| PRK06172 | 253 | short chain dehydrogenase; Provisional | 95.74 | |
| PLN02353 | 473 | probable UDP-glucose 6-dehydrogenase | 95.74 | |
| PLN02545 | 295 | 3-hydroxybutyryl-CoA dehydrogenase | 95.73 | |
| PF03721 | 185 | UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen | 95.72 | |
| PRK08628 | 258 | short chain dehydrogenase; Provisional | 95.72 | |
| PRK07066 | 321 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.71 | |
| PRK05600 | 370 | thiamine biosynthesis protein ThiF; Validated | 95.69 | |
| PRK08339 | 263 | short chain dehydrogenase; Provisional | 95.69 | |
| PLN02477 | 410 | glutamate dehydrogenase | 95.68 | |
| PRK05597 | 355 | molybdopterin biosynthesis protein MoeB; Validated | 95.67 | |
| PF05368 | 233 | NmrA: NmrA-like family; InterPro: IPR008030 NmrA i | 95.67 | |
| PRK06035 | 291 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.67 | |
| PRK06138 | 252 | short chain dehydrogenase; Provisional | 95.66 | |
| PRK06841 | 255 | short chain dehydrogenase; Provisional | 95.65 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 95.64 | |
| PRK07062 | 265 | short chain dehydrogenase; Provisional | 95.63 | |
| PRK05717 | 255 | oxidoreductase; Validated | 95.61 | |
| TIGR03589 | 324 | PseB UDP-N-acetylglucosamine 4,6-dehydratase. This | 95.61 | |
| PRK12829 | 264 | short chain dehydrogenase; Provisional | 95.61 | |
| PRK14031 | 444 | glutamate dehydrogenase; Provisional | 95.6 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 95.59 | |
| PLN02986 | 322 | cinnamyl-alcohol dehydrogenase family protein | 95.58 | |
| PRK07063 | 260 | short chain dehydrogenase; Provisional | 95.57 | |
| TIGR03325 | 262 | BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro | 95.57 | |
| PRK05867 | 253 | short chain dehydrogenase; Provisional | 95.57 | |
| PRK06057 | 255 | short chain dehydrogenase; Provisional | 95.56 | |
| PRK07890 | 258 | short chain dehydrogenase; Provisional | 95.56 | |
| PRK07688 | 339 | thiamine/molybdopterin biosynthesis ThiF/MoeB-like | 95.55 | |
| PRK08265 | 261 | short chain dehydrogenase; Provisional | 95.55 | |
| PRK06129 | 308 | 3-hydroxyacyl-CoA dehydrogenase; Validated | 95.54 | |
| PRK14874 | 334 | aspartate-semialdehyde dehydrogenase; Provisional | 95.54 | |
| PRK10637 | 457 | cysG siroheme synthase; Provisional | 95.54 | |
| PRK08220 | 252 | 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | 95.52 | |
| PRK04523 | 335 | N-acetylornithine carbamoyltransferase; Reviewed | 95.52 | |
| PLN02968 | 381 | Probable N-acetyl-gamma-glutamyl-phosphate reducta | 95.5 | |
| PRK06182 | 273 | short chain dehydrogenase; Validated | 95.49 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 95.48 | |
| PRK07097 | 265 | gluconate 5-dehydrogenase; Provisional | 95.48 | |
| COG0240 | 329 | GpsA Glycerol-3-phosphate dehydrogenase [Energy pr | 95.46 | |
| TIGR02825 | 325 | B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 | 95.44 | |
| PRK06463 | 255 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.43 | |
| PLN02662 | 322 | cinnamyl-alcohol dehydrogenase family protein | 95.43 | |
| PRK06728 | 347 | aspartate-semialdehyde dehydrogenase; Provisional | 95.43 | |
| PRK07530 | 292 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 95.42 | |
| PRK06935 | 258 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 95.42 | |
| TIGR03366 | 280 | HpnZ_proposed putative phosphonate catabolism asso | 95.42 | |
| TIGR01202 | 308 | bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl | 95.42 | |
| PRK08703 | 239 | short chain dehydrogenase; Provisional | 95.4 | |
| PLN02989 | 325 | cinnamyl-alcohol dehydrogenase family protein | 95.39 | |
| TIGR00521 | 390 | coaBC_dfp phosphopantothenoylcysteine decarboxylas | 95.38 | |
| PRK06179 | 270 | short chain dehydrogenase; Provisional | 95.37 | |
| PLN02427 | 386 | UDP-apiose/xylose synthase | 95.36 | |
| PRK09186 | 256 | flagellin modification protein A; Provisional | 95.35 | |
| PRK05854 | 313 | short chain dehydrogenase; Provisional | 95.35 | |
| KOG0023 | 360 | consensus Alcohol dehydrogenase, class V [Secondar | 95.34 | |
| PLN02896 | 353 | cinnamyl-alcohol dehydrogenase | 95.34 | |
| cd01487 | 174 | E1_ThiF_like E1_ThiF_like. Member of superfamily o | 95.33 | |
| PRK07060 | 245 | short chain dehydrogenase; Provisional | 95.32 | |
| PRK06476 | 258 | pyrroline-5-carboxylate reductase; Reviewed | 95.31 | |
| PRK08213 | 259 | gluconate 5-dehydrogenase; Provisional | 95.3 | |
| COG0771 | 448 | MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas | 95.3 | |
| PRK07478 | 254 | short chain dehydrogenase; Provisional | 95.3 | |
| PRK07634 | 245 | pyrroline-5-carboxylate reductase; Reviewed | 95.28 | |
| PTZ00142 | 470 | 6-phosphogluconate dehydrogenase; Provisional | 95.28 | |
| KOG1502 | 327 | consensus Flavonol reductase/cinnamoyl-CoA reducta | 95.26 | |
| PRK07856 | 252 | short chain dehydrogenase; Provisional | 95.26 | |
| PLN02514 | 357 | cinnamyl-alcohol dehydrogenase | 95.26 | |
| PRK05872 | 296 | short chain dehydrogenase; Provisional | 95.25 | |
| PRK09242 | 257 | tropinone reductase; Provisional | 95.25 | |
| PLN02350 | 493 | phosphogluconate dehydrogenase (decarboxylating) | 95.25 | |
| PF01113 | 124 | DapB_N: Dihydrodipicolinate reductase, N-terminus; | 95.24 | |
| PRK07035 | 252 | short chain dehydrogenase; Provisional | 95.22 | |
| PRK08416 | 260 | 7-alpha-hydroxysteroid dehydrogenase; Provisional | 95.21 | |
| PRK07680 | 273 | late competence protein ComER; Validated | 95.2 | |
| TIGR01214 | 287 | rmlD dTDP-4-dehydrorhamnose reductase. This enzyme | 95.2 | |
| PRK06196 | 315 | oxidoreductase; Provisional | 95.2 | |
| PRK13394 | 262 | 3-hydroxybutyrate dehydrogenase; Provisional | 95.2 | |
| PRK08264 | 238 | short chain dehydrogenase; Validated | 95.19 | |
| PRK04690 | 468 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.18 | |
| PRK12481 | 251 | 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | 95.17 | |
| PRK06125 | 259 | short chain dehydrogenase; Provisional | 95.15 | |
| cd08293 | 345 | PTGR2 Prostaglandin reductase. Prostaglandins and | 95.15 | |
| PRK07411 | 390 | hypothetical protein; Validated | 95.14 | |
| PRK09291 | 257 | short chain dehydrogenase; Provisional | 95.13 | |
| PRK07878 | 392 | molybdopterin biosynthesis-like protein MoeZ; Vali | 95.12 | |
| PLN02695 | 370 | GDP-D-mannose-3',5'-epimerase | 95.11 | |
| PRK08936 | 261 | glucose-1-dehydrogenase; Provisional | 95.11 | |
| PRK08229 | 341 | 2-dehydropantoate 2-reductase; Provisional | 95.1 | |
| PRK05876 | 275 | short chain dehydrogenase; Provisional | 95.09 | |
| PRK07774 | 250 | short chain dehydrogenase; Provisional | 95.09 | |
| PRK07814 | 263 | short chain dehydrogenase; Provisional | 95.09 | |
| cd08294 | 329 | leukotriene_B4_DH_like 13-PGR is a bifunctional en | 95.09 | |
| PRK05786 | 238 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 95.09 | |
| PRK12826 | 251 | 3-ketoacyl-(acyl-carrier-protein) reductase; Revie | 95.08 | |
| PRK07531 | 495 | bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe | 95.08 | |
| PRK06114 | 254 | short chain dehydrogenase; Provisional | 95.08 | |
| PRK06194 | 287 | hypothetical protein; Provisional | 95.08 | |
| PRK08589 | 272 | short chain dehydrogenase; Validated | 95.07 | |
| PRK06200 | 263 | 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog | 95.07 | |
| PRK08277 | 278 | D-mannonate oxidoreductase; Provisional | 95.06 | |
| PRK06500 | 249 | short chain dehydrogenase; Provisional | 95.06 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 95.06 | |
| PRK04308 | 445 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.06 | |
| COG0604 | 326 | Qor NADPH:quinone reductase and related Zn-depende | 95.06 | |
| PLN02178 | 375 | cinnamyl-alcohol dehydrogenase | 95.05 | |
| PRK07825 | 273 | short chain dehydrogenase; Provisional | 95.05 | |
| PF04127 | 185 | DFP: DNA / pantothenate metabolism flavoprotein; I | 95.05 | |
| PRK15057 | 388 | UDP-glucose 6-dehydrogenase; Provisional | 95.04 | |
| PRK12743 | 256 | oxidoreductase; Provisional | 95.04 | |
| PRK12429 | 258 | 3-hydroxybutyrate dehydrogenase; Provisional | 95.03 | |
| PRK15181 | 348 | Vi polysaccharide biosynthesis protein TviC; Provi | 95.03 | |
| PLN02778 | 298 | 3,5-epimerase/4-reductase | 95.03 | |
| PLN02858 | 1378 | fructose-bisphosphate aldolase | 95.01 | |
| PRK07067 | 257 | sorbitol dehydrogenase; Provisional | 95.01 | |
| PLN02214 | 342 | cinnamoyl-CoA reductase | 95.01 | |
| PRK02006 | 498 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 95.0 | |
| PRK05225 | 487 | ketol-acid reductoisomerase; Validated | 94.95 | |
| PLN03209 | 576 | translocon at the inner envelope of chloroplast su | 94.94 | |
| PF13738 | 203 | Pyr_redox_3: Pyridine nucleotide-disulphide oxidor | 94.93 | |
| TIGR02279 | 503 | PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa | 94.92 | |
| COG0540 | 316 | PyrB Aspartate carbamoyltransferase, catalytic cha | 94.92 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 94.89 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 94.89 | |
| PRK06079 | 252 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.88 | |
| PLN02383 | 344 | aspartate semialdehyde dehydrogenase | 94.88 | |
| PRK01390 | 460 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.87 | |
| PRK12823 | 260 | benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat | 94.86 | |
| PRK07576 | 264 | short chain dehydrogenase; Provisional | 94.85 | |
| PRK12742 | 237 | oxidoreductase; Provisional | 94.85 | |
| TIGR00873 | 467 | gnd 6-phosphogluconate dehydrogenase, decarboxylat | 94.84 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 94.83 | |
| PTZ00079 | 454 | NADP-specific glutamate dehydrogenase; Provisional | 94.83 | |
| PRK06505 | 271 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.83 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 94.82 | |
| PRK07533 | 258 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.82 | |
| PRK14806 | 735 | bifunctional cyclohexadienyl dehydrogenase/ 3-phos | 94.81 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 94.81 | |
| PLN02657 | 390 | 3,8-divinyl protochlorophyllide a 8-vinyl reductas | 94.81 | |
| PRK07666 | 239 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.8 | |
| PRK08268 | 507 | 3-hydroxy-acyl-CoA dehydrogenase; Validated | 94.79 | |
| PRK06139 | 330 | short chain dehydrogenase; Provisional | 94.78 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 94.76 | |
| PRK12939 | 250 | short chain dehydrogenase; Provisional | 94.76 | |
| TIGR01850 | 346 | argC N-acetyl-gamma-glutamyl-phosphate reductase, | 94.75 | |
| KOG1201 | 300 | consensus Hydroxysteroid 17-beta dehydrogenase 11 | 94.73 | |
| PRK05557 | 248 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.72 | |
| TIGR03466 | 328 | HpnA hopanoid-associated sugar epimerase. The sequ | 94.72 | |
| TIGR03206 | 250 | benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr | 94.72 | |
| PRK05653 | 246 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.71 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 94.7 | |
| TIGR03376 | 342 | glycerol3P_DH glycerol-3-phosphate dehydrogenase ( | 94.68 | |
| PRK06153 | 393 | hypothetical protein; Provisional | 94.65 | |
| PRK07326 | 237 | short chain dehydrogenase; Provisional | 94.65 | |
| PRK08226 | 263 | short chain dehydrogenase; Provisional | 94.65 | |
| PRK07806 | 248 | short chain dehydrogenase; Provisional | 94.65 | |
| PRK08278 | 273 | short chain dehydrogenase; Provisional | 94.64 | |
| PRK05875 | 276 | short chain dehydrogenase; Provisional | 94.62 | |
| PRK08217 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.61 | |
| PLN00106 | 323 | malate dehydrogenase | 94.59 | |
| PRK13376 | 525 | pyrB bifunctional aspartate carbamoyltransferase c | 94.58 | |
| PRK05565 | 247 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.57 | |
| PRK07792 | 306 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.55 | |
| PRK09414 | 445 | glutamate dehydrogenase; Provisional | 94.54 | |
| TIGR01851 | 310 | argC_other N-acetyl-gamma-glutamyl-phosphate reduc | 94.53 | |
| PRK06197 | 306 | short chain dehydrogenase; Provisional | 94.53 | |
| smart00859 | 122 | Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin | 94.51 | |
| TIGR01777 | 292 | yfcH conserved hypothetical protein TIGR01777. Thi | 94.5 | |
| KOG1494 | 345 | consensus NAD-dependent malate dehydrogenase [Ener | 94.49 | |
| PRK06914 | 280 | short chain dehydrogenase; Provisional | 94.47 | |
| PRK06701 | 290 | short chain dehydrogenase; Provisional | 94.47 | |
| KOG0725 | 270 | consensus Reductases with broad range of substrate | 94.44 | |
| PLN02253 | 280 | xanthoxin dehydrogenase | 94.42 | |
| PRK05693 | 274 | short chain dehydrogenase; Provisional | 94.42 | |
| PLN02653 | 340 | GDP-mannose 4,6-dehydratase | 94.42 | |
| cd08239 | 339 | THR_DH_like L-threonine dehydrogenase (TDH)-like. | 94.41 | |
| PRK12827 | 249 | short chain dehydrogenase; Provisional | 94.41 | |
| PRK08643 | 256 | acetoin reductase; Validated | 94.4 | |
| COG0059 | 338 | IlvC Ketol-acid reductoisomerase [Amino acid trans | 94.39 | |
| PRK12937 | 245 | short chain dehydrogenase; Provisional | 94.38 | |
| PRK08594 | 257 | enoyl-(acyl carrier protein) reductase; Provisiona | 94.37 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 94.37 | |
| PRK12936 | 245 | 3-ketoacyl-(acyl-carrier-protein) reductase NodG; | 94.36 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 94.35 | |
| PRK06113 | 255 | 7-alpha-hydroxysteroid dehydrogenase; Validated | 94.34 | |
| PF00070 | 80 | Pyr_redox: Pyridine nucleotide-disulphide oxidored | 94.34 | |
| COG1090 | 297 | Predicted nucleoside-diphosphate sugar epimerase [ | 94.34 | |
| PRK12769 | 654 | putative oxidoreductase Fe-S binding subunit; Revi | 94.32 | |
| COG2072 | 443 | TrkA Predicted flavoprotein involved in K+ transpo | 94.31 | |
| PRK11863 | 313 | N-acetyl-gamma-glutamyl-phosphate reductase; Provi | 94.28 | |
| PRK07985 | 294 | oxidoreductase; Provisional | 94.26 | |
| PRK07677 | 252 | short chain dehydrogenase; Provisional | 94.26 | |
| PRK15182 | 425 | Vi polysaccharide biosynthesis protein TviB; Provi | 94.25 | |
| PRK07109 | 334 | short chain dehydrogenase; Provisional | 94.24 | |
| TIGR01963 | 255 | PHB_DH 3-hydroxybutyrate dehydrogenase. This model | 94.23 | |
| PRK05993 | 277 | short chain dehydrogenase; Provisional | 94.22 | |
| PLN02206 | 442 | UDP-glucuronate decarboxylase | 94.22 | |
| PRK08642 | 253 | fabG 3-ketoacyl-(acyl-carrier-protein) reductase; | 94.2 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 94.2 | |
| PRK09135 | 249 | pteridine reductase; Provisional | 94.18 | |
| PRK14030 | 445 | glutamate dehydrogenase; Provisional | 94.18 | |
| PRK08303 | 305 | short chain dehydrogenase; Provisional | 94.18 | |
| PRK06198 | 260 | short chain dehydrogenase; Provisional | 94.17 | |
| PLN02730 | 303 | enoyl-[acyl-carrier-protein] reductase | 94.17 | |
| PRK01368 | 454 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 94.15 | |
| TIGR02622 | 349 | CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member | 94.14 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 94.12 | |
| PRK07577 | 234 | short chain dehydrogenase; Provisional | 94.11 | |
| PRK08267 | 260 | short chain dehydrogenase; Provisional | 94.1 | |
| cd08292 | 324 | ETR_like_2 2-enoyl thioester reductase (ETR) like | 94.09 | |
| PRK08040 | 336 | putative semialdehyde dehydrogenase; Provisional | 94.09 | |
| PRK08328 | 231 | hypothetical protein; Provisional | 94.05 | |
| PLN03154 | 348 | putative allyl alcohol dehydrogenase; Provisional | 94.02 | |
| PRK12809 | 639 | putative oxidoreductase Fe-S binding subunit; Revi | 94.01 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 94.01 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 93.99 | |
| PRK08993 | 253 | 2-deoxy-D-gluconate 3-dehydrogenase; Validated | 93.98 | |
| PRK06483 | 236 | dihydromonapterin reductase; Provisional | 93.96 | |
| TIGR01724 | 341 | hmd_rel H2-forming N(5),N(10)-methenyltetrahydrome | 93.95 | |
| cd08253 | 325 | zeta_crystallin Zeta-crystallin with NADP-dependen | 93.93 | |
| PRK08945 | 247 | putative oxoacyl-(acyl carrier protein) reductase; | 93.93 | |
| PRK06128 | 300 | oxidoreductase; Provisional | 93.93 | |
| PRK07984 | 262 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.93 | |
| PRK06444 | 197 | prephenate dehydrogenase; Provisional | 93.91 | |
| TIGR03026 | 411 | NDP-sugDHase nucleotide sugar dehydrogenase. All o | 93.9 | |
| PRK06180 | 277 | short chain dehydrogenase; Provisional | 93.89 | |
| PRK07370 | 258 | enoyl-(acyl carrier protein) reductase; Validated | 93.86 | |
| PRK06603 | 260 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.85 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 93.85 | |
| cd05282 | 323 | ETR_like 2-enoyl thioester reductase-like. 2-enoyl | 93.85 | |
| PRK12384 | 259 | sorbitol-6-phosphate dehydrogenase; Provisional | 93.84 | |
| PRK11880 | 267 | pyrroline-5-carboxylate reductase; Reviewed | 93.82 | |
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 93.81 | |
| PRK07831 | 262 | short chain dehydrogenase; Provisional | 93.81 | |
| PLN02583 | 297 | cinnamoyl-CoA reductase | 93.81 | |
| PRK08415 | 274 | enoyl-(acyl carrier protein) reductase; Provisiona | 93.8 | |
| PF00185 | 158 | OTCace: Aspartate/ornithine carbamoyltransferase, | 93.74 | |
| COG1250 | 307 | FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo | 93.69 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 93.67 | |
| PTZ00345 | 365 | glycerol-3-phosphate dehydrogenase; Provisional | 93.66 | |
| PRK00683 | 418 | murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn | 93.66 | |
| PRK00436 | 343 | argC N-acetyl-gamma-glutamyl-phosphate reductase; | 93.65 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 93.65 | |
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 93.64 | |
| PRK11730 | 715 | fadB multifunctional fatty acid oxidation complex | 93.62 | |
| cd08295 | 338 | double_bond_reductase_like Arabidopsis alkenal dou | 93.62 |
| >COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-80 Score=551.81 Aligned_cols=259 Identities=54% Similarity=0.854 Sum_probs=250.3
Q ss_pred CCCCCCCCeEEEEEeCCCcchHHHHHHHHHHHHHcCCeEEEEEcCCCCCHHHHHHHHHhhhcCCCcCEEEEeCCCCCCCC
Q 024282 2 KKSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSNYNQDSSINGILVQLPLPQHLD 81 (269)
Q Consensus 2 ~~~~~~~p~L~~i~vg~~~~s~~y~~~~~~~~~~~Gi~~~~~~~~~~~~~~~l~~~i~~ln~d~~v~Gi~V~~Pl~~~~~ 81 (269)
+++.+.+|+|++|++|+||+|+.|+++|.++|+++|+.++.+.||++++++||++.|++||+|++||||+||+|||+|+|
T Consensus 24 ~~~~~~~P~LavilvgddpaS~~YV~~K~k~~~~iGi~~~~~~l~~~~t~~eLl~~I~~lN~D~~v~GIlVQlPLp~hld 103 (283)
T COG0190 24 KAKGGFKPGLAVILVGDDPASQVYVRSKKKAAEEIGIASELYDLPEDITEEELLALIDELNADPEVDGILVQLPLPKHLD 103 (283)
T ss_pred HhccCCCceEEEEEeCCCHHHHHHHHHHHHHHHHcCCeeEEEeCCCcCCHHHHHHHHHHhcCCCCCcEEEEeCCCCCCCC
Confidence 34568899999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCCccccccccccceecccccCCCCCccccCCHHHHHHHHHHhCCCCccceEEEEcCCcccHHHHHHHHHhCCC
Q 024282 82 EGKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHA 161 (269)
Q Consensus 82 ~~~i~~~i~p~kdvdg~~~~n~g~l~~g~~~~~~~p~t~~g~~~~l~~~~~~l~gk~v~ViG~gg~vg~~~a~~L~~~ga 161 (269)
+.+++++|+|+|||||||++|.|+|..+ ++.|+||||.|++++|++|+++++||+++|||||..||||++++|...+|
T Consensus 104 ~~~il~~I~p~KDVDG~hp~N~g~L~~~--~~~~~PCTp~gi~~ll~~~~i~l~Gk~~vVVGrS~iVGkPla~lL~~~na 181 (283)
T COG0190 104 EQKLLQAIDPEKDVDGFHPYNLGKLAQG--EPGFLPCTPAGIMTLLEEYGIDLRGKNVVVVGRSNIVGKPLALLLLNANA 181 (283)
T ss_pred HHHHHhhcCcCCCccccChhHhcchhcC--CCCCCCCCHHHHHHHHHHhCCCCCCCEEEEECCCCcCcHHHHHHHHhCCC
Confidence 9999999999999999999999999865 77899999999999999999999999999999999999999999999999
Q ss_pred EEEEEeCCCCCHhhhcCCCCEEEeccCCCCcccCCCcCCCcEEEEeeecCCCCCCCCCCceeecccchHHHhhHcceecc
Q 024282 162 TVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVITP 241 (269)
Q Consensus 162 ~Vti~~~~t~~l~~~~~~aDiVIsAtg~p~~i~~~~~~~g~vViDv~~~~~~~~~~~~~~~l~GDvd~~~~~~~~~~~tp 241 (269)
+||+||++|+++.+++++|||||+|+|+|++++.+|+++|++|||+|+|+.++ ++++|||||+++.++++++||
T Consensus 182 TVtvcHs~T~~l~~~~k~ADIvv~AvG~p~~i~~d~vk~gavVIDVGinrv~~------~kl~GDVdf~~v~~~a~~iTP 255 (283)
T COG0190 182 TVTVCHSRTKDLASITKNADIVVVAVGKPHFIKADMVKPGAVVIDVGINRVND------GKLVGDVDFDSVKEKASAITP 255 (283)
T ss_pred EEEEEcCCCCCHHHHhhhCCEEEEecCCccccccccccCCCEEEecCCccccC------CceEeeccHHHHHHhhcccCC
Confidence 99999999999999999999999999999999999999999999999999864 289999999999999999999
Q ss_pred cCCcccHHHHHHHHHHHHHHHHHHhCC
Q 024282 242 VPGGVGPMTVAMLLSNTLDSAKRAYGF 268 (269)
Q Consensus 242 vpgGvGp~T~~mLl~n~v~a~~~~~~~ 268 (269)
|||||||||++|||+|+++++++..+.
T Consensus 256 VPGGVGPmTvamLl~Nt~~a~~~~~~~ 282 (283)
T COG0190 256 VPGGVGPMTVAMLLENTLKAAERQRGE 282 (283)
T ss_pred CCCccCHHHHHHHHHHHHHHHHHHhcc
Confidence 999999999999999999999987664
|
|
| >PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative | Back alignment and domain information |
|---|
| >PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) | Back alignment and domain information |
|---|
| >PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4230 consensus C1-tetrahydrofolate synthase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG0089 consensus Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase | Back alignment and domain information |
|---|
| >cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase | Back alignment and domain information |
|---|
| >PRK12549 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12749 quinate/shikimate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12548 shikimate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14027 quinate/shikimate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type | Back alignment and domain information |
|---|
| >PRK12550 shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK00258 aroE shikimate 5-dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00507 aroE shikimate 5-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed | Back alignment and domain information |
|---|
| >PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) | Back alignment and domain information |
|---|
| >PRK08306 dipicolinate synthase subunit A; Reviewed | Back alignment and domain information |
|---|
| >TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit | Back alignment and domain information |
|---|
| >cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase | Back alignment and domain information |
|---|
| >PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases | Back alignment and domain information |
|---|
| >COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 | Back alignment and domain information |
|---|
| >PRK13940 glutamyl-tRNA reductase; Provisional | Back alignment and domain information |
|---|
| >cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase | Back alignment and domain information |
|---|
| >PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 | Back alignment and domain information |
|---|
| >PRK14982 acyl-ACP reductase; Provisional | Back alignment and domain information |
|---|
| >PF08501 Shikimate_dh_N: Shikimate dehydrogenase substrate binding domain; InterPro: IPR013708 This domain is the substrate binding domain of shikimate dehydrogenase [] | Back alignment and domain information |
|---|
| >PTZ00075 Adenosylhomocysteinase; Provisional | Back alignment and domain information |
|---|
| >PRK00676 hemA glutamyl-tRNA reductase; Validated | Back alignment and domain information |
|---|
| >PLN00203 glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK00045 hemA glutamyl-tRNA reductase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01035 hemA glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00936 ahcY adenosylhomocysteinase | Back alignment and domain information |
|---|
| >cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase | Back alignment and domain information |
|---|
| >COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG5322 Predicted dehydrogenase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02928 oxidoreductase family protein | Back alignment and domain information |
|---|
| >TIGR00518 alaDH alanine dehydrogenase | Back alignment and domain information |
|---|
| >TIGR02992 ectoine_eutC ectoine utilization protein EutC | Back alignment and domain information |
|---|
| >cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) | Back alignment and domain information |
|---|
| >PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related | Back alignment and domain information |
|---|
| >PLN02494 adenosylhomocysteinase | Back alignment and domain information |
|---|
| >PRK00257 erythronate-4-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional | Back alignment and domain information |
|---|
| >PRK08291 ectoine utilization protein EutC; Validated | Back alignment and domain information |
|---|
| >PRK13243 glyoxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit | Back alignment and domain information |
|---|
| >cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >PRK07574 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06718 precorrin-2 dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08618 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional | Back alignment and domain information |
|---|
| >COG0281 SfcA Malic enzyme [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06932 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06436 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06487 glycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK06141 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK08410 2-hydroxyacid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03139 formate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed | Back alignment and domain information |
|---|
| >PRK12862 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >KOG1370 consensus S-adenosylhomocysteine hydrolase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08605 D-lactate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07340 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional | Back alignment and domain information |
|---|
| >PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 | Back alignment and domain information |
|---|
| >PRK12480 D-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02306 hydroxypyruvate reductase | Back alignment and domain information |
|---|
| >PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 | Back alignment and domain information |
|---|
| >COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK12861 malic enzyme; Reviewed | Back alignment and domain information |
|---|
| >PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B | Back alignment and domain information |
|---|
| >PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK06719 precorrin-2 dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] | Back alignment and domain information |
|---|
| >PRK14619 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate | Back alignment and domain information |
|---|
| >PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0069 consensus Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily) [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06823 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >TIGR02371 ala_DH_arch alanine dehydrogenase, Archaeoglobus fulgidus type | Back alignment and domain information |
|---|
| >PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain | Back alignment and domain information |
|---|
| >PRK06407 ornithine cyclodeaminase; Provisional | Back alignment and domain information |
|---|
| >cd05312 NAD_bind_1_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 1 | Back alignment and domain information |
|---|
| >PF02423 OCD_Mu_crystall: Ornithine cyclodeaminase/mu-crystallin family; InterPro: IPR003462 This entry represents the bacterial ornithine cyclodeaminase enzyme family, which catalyse the deamination of ornithine to proline [] | Back alignment and domain information |
|---|
| >TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain | Back alignment and domain information |
|---|
| >cd00762 NAD_bind_malic_enz NAD(P) binding domain of malic enzyme | Back alignment and domain information |
|---|
| >PRK06046 alanine dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF03949 Malic_M: Malic enzyme, NAD binding domain; InterPro: IPR012302 Malic enzymes (malate oxidoreductases) catalyse the oxidative decarboxylation of malate to form pyruvate [], a reaction important in a number of metabolic pathways - e | Back alignment and domain information |
|---|
| >PRK14804 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PRK07589 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates | Back alignment and domain information |
|---|
| >COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01505 tartro_sem_red 2-hydroxy-3-oxopropionate reductase | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13529 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02256 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK11559 garR tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK01713 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04284 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK03515 ornithine carbamoyltransferase subunit I; Provisional | Back alignment and domain information |
|---|
| >COG1648 CysG Siroheme synthase (precorrin-2 oxidase/ferrochelatase domain) [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15461 NADH-dependent gamma-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR00670 asp_carb_tr aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated | Back alignment and domain information |
|---|
| >PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >PLN03129 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK07502 cyclohexadienyl dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK02102 ornithine carbamoyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK05562 precorrin-2 dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PRK12562 ornithine carbamoyltransferase subunit F; Provisional | Back alignment and domain information |
|---|
| >PLN02342 ornithine carbamoyltransferase | Back alignment and domain information |
|---|
| >PRK13403 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK02255 putrescine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00658 orni_carb_tr ornithine carbamoyltransferase | Back alignment and domain information |
|---|
| >PLN02527 aspartate carbamoyltransferase | Back alignment and domain information |
|---|
| >PRK06545 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK07417 arogenate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK14805 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2017 consensus Molybdopterin synthase sulfurylase [Coenzyme transport and metabolism] | Back alignment and domain information |
|---|
| >COG2423 Predicted ornithine cyclodeaminase, mu-crystallin homolog [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00779 ornithine carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B | Back alignment and domain information |
|---|
| >PRK08818 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11891 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05479 ketol-acid reductoisomerase; Provisional | Back alignment and domain information |
|---|
| >PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate | Back alignment and domain information |
|---|
| >PRK08655 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 | Back alignment and domain information |
|---|
| >TIGR03316 ygeW probable carbamoyltransferase YgeW | Back alignment and domain information |
|---|
| >PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01692 HIBADH 3-hydroxyisobutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06199 ornithine cyclodeaminase; Validated | Back alignment and domain information |
|---|
| >PRK07679 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK15059 tartronate semialdehyde reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06398 aldose dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12491 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08192 aspartate carbamoyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08223 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 | Back alignment and domain information |
|---|
| >PRK06949 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06523 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR00465 ilvC ketol-acid reductoisomerase | Back alignment and domain information |
|---|
| >PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E | Back alignment and domain information |
|---|
| >PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PTZ00317 NADP-dependent malic enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02355 moeB molybdopterin synthase sulfurylase MoeB | Back alignment and domain information |
|---|
| >PRK12367 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00872 gnd_rel 6-phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 | Back alignment and domain information |
|---|
| >PRK08507 prephenate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase | Back alignment and domain information |
|---|
| >cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 | Back alignment and domain information |
|---|
| >cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA | Back alignment and domain information |
|---|
| >PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase | Back alignment and domain information |
|---|
| >PLN02586 probable cinnamyl alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PLN02688 pyrroline-5-carboxylate reductase | Back alignment and domain information |
|---|
| >PRK09072 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated | Back alignment and domain information |
|---|
| >PRK05690 molybdopterin biosynthesis protein MoeB; Provisional | Back alignment and domain information |
|---|
| >cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 | Back alignment and domain information |
|---|
| >PRK12828 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG2910 Putative NADH-flavin reductase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02712 arogenate dehydrogenase | Back alignment and domain information |
|---|
| >PRK07523 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK08644 thiamine biosynthesis protein ThiF; Provisional | Back alignment and domain information |
|---|
| >TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase | Back alignment and domain information |
|---|
| >PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05866 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08862 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >CHL00194 ycf39 Ycf39; Provisional | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK08762 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP | Back alignment and domain information |
|---|
| >PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06124 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional | Back alignment and domain information |
|---|
| >PLN00141 Tic62-NAD(P)-related group II protein; Provisional | Back alignment and domain information |
|---|
| >PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG3288 PntA NAD/NADP transhydrogenase alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1198 consensus Zinc-binding oxidoreductase [Energy production and conversion; General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase | Back alignment and domain information |
|---|
| >COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08085 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >PRK06172 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02353 probable UDP-glucose 6-dehydrogenase | Back alignment and domain information |
|---|
| >PLN02545 3-hydroxybutyryl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] | Back alignment and domain information |
|---|
| >PRK08628 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK05600 thiamine biosynthesis protein ThiF; Validated | Back alignment and domain information |
|---|
| >PRK08339 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02477 glutamate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05597 molybdopterin biosynthesis protein MoeB; Validated | Back alignment and domain information |
|---|
| >PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA | Back alignment and domain information |
|---|
| >PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06138 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06841 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07062 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05717 oxidoreductase; Validated | Back alignment and domain information |
|---|
| >TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase | Back alignment and domain information |
|---|
| >PRK12829 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK14031 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
| >PLN02986 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK07063 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05867 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06057 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07890 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated | Back alignment and domain information |
|---|
| >PRK08265 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK14874 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK10637 cysG siroheme synthase; Provisional | Back alignment and domain information |
|---|
| >PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04523 N-acetylornithine carbamoyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase | Back alignment and domain information |
|---|
| >PRK06182 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK07097 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase | Back alignment and domain information |
|---|
| >PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02662 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >PRK06728 aspartate-semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase | Back alignment and domain information |
|---|
| >PRK08703 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02989 cinnamyl-alcohol dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic | Back alignment and domain information |
|---|
| >PRK06179 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02427 UDP-apiose/xylose synthase | Back alignment and domain information |
|---|
| >PRK09186 flagellin modification protein A; Provisional | Back alignment and domain information |
|---|
| >PRK05854 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02896 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >cd01487 E1_ThiF_like E1_ThiF_like | Back alignment and domain information |
|---|
| >PRK07060 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06476 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK08213 gluconate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK07478 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07634 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00142 6-phosphogluconate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK07856 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02514 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK05872 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK09242 tropinone reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02350 phosphogluconate dehydrogenase (decarboxylating) | Back alignment and domain information |
|---|
| >PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] | Back alignment and domain information |
|---|
| >PRK07035 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07680 late competence protein ComER; Validated | Back alignment and domain information |
|---|
| >TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase | Back alignment and domain information |
|---|
| >PRK06196 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK13394 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08264 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06125 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08293 PTGR2 Prostaglandin reductase | Back alignment and domain information |
|---|
| >PRK07411 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09291 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated | Back alignment and domain information |
|---|
| >PLN02695 GDP-D-mannose-3',5'-epimerase | Back alignment and domain information |
|---|
| >PRK08936 glucose-1-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08229 2-dehydropantoate 2-reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05876 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07774 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07814 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity | Back alignment and domain information |
|---|
| >PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed | Back alignment and domain information |
|---|
| >PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated | Back alignment and domain information |
|---|
| >PRK06114 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06194 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08589 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08277 D-mannonate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK06500 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] | Back alignment and domain information |
|---|
| >PLN02178 cinnamyl-alcohol dehydrogenase | Back alignment and domain information |
|---|
| >PRK07825 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism | Back alignment and domain information |
|---|
| >PRK15057 UDP-glucose 6-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12743 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK12429 3-hydroxybutyrate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional | Back alignment and domain information |
|---|
| >PLN02778 3,5-epimerase/4-reductase | Back alignment and domain information |
|---|
| >PLN02858 fructose-bisphosphate aldolase | Back alignment and domain information |
|---|
| >PRK07067 sorbitol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02214 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK05225 ketol-acid reductoisomerase; Validated | Back alignment and domain information |
|---|
| >PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional | Back alignment and domain information |
|---|
| >PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A | Back alignment and domain information |
|---|
| >TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC | Back alignment and domain information |
|---|
| >COG0540 PyrB Aspartate carbamoyltransferase, catalytic chain [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK06079 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02383 aspartate semialdehyde dehydrogenase | Back alignment and domain information |
|---|
| >PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07576 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12742 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >TIGR00873 gnd 6-phosphogluconate dehydrogenase, decarboxylating | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >PTZ00079 NADP-specific glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06505 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK07533 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14806 bifunctional cyclohexadienyl dehydrogenase/ 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase | Back alignment and domain information |
|---|
| >PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06139 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK12939 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form | Back alignment and domain information |
|---|
| >KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >TIGR03466 HpnA hopanoid-associated sugar epimerase | Back alignment and domain information |
|---|
| >TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase | Back alignment and domain information |
|---|
| >PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) | Back alignment and domain information |
|---|
| >PRK06153 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07326 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08226 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07806 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08278 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK05875 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK09414 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form | Back alignment and domain information |
|---|
| >PRK06197 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >TIGR01777 yfcH conserved hypothetical protein TIGR01777 | Back alignment and domain information |
|---|
| >KOG1494 consensus NAD-dependent malate dehydrogenase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK06914 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06701 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02253 xanthoxin dehydrogenase | Back alignment and domain information |
|---|
| >PRK05693 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02653 GDP-mannose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like | Back alignment and domain information |
|---|
| >PRK12827 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08643 acetoin reductase; Validated | Back alignment and domain information |
|---|
| >COG0059 IlvC Ketol-acid reductoisomerase [Amino acid transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK12937 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08594 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] | Back alignment and domain information |
|---|
| >COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK07985 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07677 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK15182 Vi polysaccharide biosynthesis protein TviB; Provisional | Back alignment and domain information |
|---|
| >PRK07109 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase | Back alignment and domain information |
|---|
| >PRK05993 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02206 UDP-glucuronate decarboxylase | Back alignment and domain information |
|---|
| >PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PRK09135 pteridine reductase; Provisional | Back alignment and domain information |
|---|
| >PRK14030 glutamate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08303 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06198 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02730 enoyl-[acyl-carrier-protein] reductase | Back alignment and domain information |
|---|
| >PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >PRK07577 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08267 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 | Back alignment and domain information |
|---|
| >PRK08040 putative semialdehyde dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK08328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN03154 putative allyl alcohol dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK06483 dihydromonapterin reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR01724 hmd_rel H2-forming N(5),N(10)-methenyltetrahydromethanopterin dehydrogenase-related protein | Back alignment and domain information |
|---|
| >cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) | Back alignment and domain information |
|---|
| >PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06128 oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK07984 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06444 prephenate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase | Back alignment and domain information |
|---|
| >PRK06180 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK07370 enoyl-(acyl carrier protein) reductase; Validated | Back alignment and domain information |
|---|
| >PRK06603 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >cd05282 ETR_like 2-enoyl thioester reductase-like | Back alignment and domain information |
|---|
| >PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK11880 pyrroline-5-carboxylate reductase; Reviewed | Back alignment and domain information |
|---|
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK07831 short chain dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02583 cinnamoyl-CoA reductase | Back alignment and domain information |
|---|
| >PRK08415 enoyl-(acyl carrier protein) reductase; Provisional | Back alignment and domain information |
|---|
| >PF00185 OTCace: Aspartate/ornithine carbamoyltransferase, Asp/Orn binding domain; InterPro: IPR006131 This family contains two related enzymes: Aspartate carbamoyltransferase (2 | Back alignment and domain information |
|---|
| >COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >PTZ00345 glycerol-3-phosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional | Back alignment and domain information |
|---|
| >PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 269 | ||||
| 4a26_A | 300 | The Crystal Structure Of Leishmania Major N5,N10- M | 1e-72 | ||
| 1dia_A | 306 | Human Methylenetetrahydrofolate Dehydrogenase Cyclo | 4e-63 | ||
| 1a4i_A | 301 | Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE | 5e-63 | ||
| 4a5o_A | 286 | Crystal Structure Of Pseudomonas Aeruginosa N5, N10 | 6e-62 | ||
| 3p2o_A | 285 | Crystal Structure Of Fold Bifunctional Protein From | 1e-60 | ||
| 1b0a_A | 288 | 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL | 5e-59 | ||
| 3l07_A | 285 | Methylenetetrahydrofolate DehydrogenaseMETHENYLTETR | 3e-53 | ||
| 4b4u_A | 303 | Crystal Structure Of Acinetobacter Baumannii N5, N1 | 7e-52 | ||
| 2c2x_A | 281 | Three Dimensional Structure Of Bifunctional Methyle | 2e-49 | ||
| 3ngl_A | 276 | Crystal Structure Of Bifunctional 5,10-Methylenetet | 2e-34 | ||
| 1edz_A | 320 | Structure Of The Nad-Dependent 5,10- Methylenetetra | 4e-11 |
| >pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 | Back alignment and structure |
|
| >pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 | Back alignment and structure |
| >pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 | Back alignment and structure |
| >pdb|4A5O|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa N5, N10- Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Length = 286 | Back alignment and structure |
| >pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 | Back alignment and structure |
| >pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 | Back alignment and structure |
| >pdb|3L07|A Chain A, Methylenetetrahydrofolate DehydrogenaseMETHENYLTETRAHYDROFOLATE Cyclohydrolase, Putative Bifunctional Protein Fold From Francisella Tularensis. Length = 285 | Back alignment and structure |
| >pdb|4B4U|A Chain A, Crystal Structure Of Acinetobacter Baumannii N5, N10-Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Complexed With Nadp Cofactor Length = 303 | Back alignment and structure |
| >pdb|2C2X|A Chain A, Three Dimensional Structure Of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase From Mycobacterium Tuberculosis Length = 281 | Back alignment and structure |
| >pdb|3NGL|A Chain A, Crystal Structure Of Bifunctional 5,10-Methylenetetrahydrofolate Dehydrogenase CYCLOHYDROLASE FROM THERMOPLASMA ACIDOPHILUM Length = 276 | Back alignment and structure |
| >pdb|1EDZ|A Chain A, Structure Of The Nad-Dependent 5,10- Methylenetetrahydrofolate Dehydrogenase From Saccharomyces Cerevisiae Length = 320 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 269 | |||
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 1e-161 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 1e-159 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 1e-146 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 1e-146 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 1e-146 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 1e-145 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 1e-139 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 1e-136 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 1e-113 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 8e-09 |
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 | Back alignment and structure |
|---|
Score = 448 bits (1155), Expect = e-161
Identities = 137/268 (51%), Positives = 183/268 (68%), Gaps = 2/268 (0%)
Query: 2 KKSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSNY 61
+ G+VPGLA I+VG+R DS+ YV+ K KA EVG+ S E + +++ + +
Sbjct: 31 ELYGGRVPGLASIIVGQRMDSKKYVQLKHKAAAEVGMASFNVELPEDISQEVLEVNVEKL 90
Query: 62 NQDSSINGILVQLPLPQHLDEGKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTPK 121
N D + +GI+VQLPLP+HL+E + ++ + KD D P+N+G L +GREP F PCT K
Sbjct: 91 NNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDADALLPVNVGLLHYKGREPPFTPCTAK 150
Query: 122 GCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHAL--TKNPEQITSE 179
G I LL R G+E+ GK AVV+GRSNIVG P + LL + +ATV+IVH+ T++
Sbjct: 151 GVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMKENATVTIVHSGTSTEDMIDYLRT 210
Query: 180 ADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVI 239
ADIVIAA G V+G W+K GA V+DVGT PV DPS + GYRL+GDVC+EEA A+ I
Sbjct: 211 ADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDPSRKDGYRLVGDVCFEEAAARAAWI 270
Query: 240 TPVPGGVGPMTVAMLLSNTLDSAKRAYG 267
+PVPGGVGPMT+AMLL NTL++ K A G
Sbjct: 271 SPVPGGVGPMTIAMLLENTLEAFKAALG 298
|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Length = 293 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| 4b4u_A | 303 | Bifunctional protein fold; oxidoreductase; HET: NA | 100.0 | |
| 4a26_A | 300 | Putative C-1-tetrahydrofolate synthase, cytoplasm; | 100.0 | |
| 4a5o_A | 286 | Bifunctional protein fold; oxidoreductase, hydrola | 100.0 | |
| 3p2o_A | 285 | Bifunctional protein fold; structural genomics, ce | 100.0 | |
| 3l07_A | 285 | Bifunctional protein fold; structural genomics, ID | 100.0 | |
| 1a4i_A | 301 | Methylenetetrahydrofolate dehydrogenase / methenyl | 100.0 | |
| 1b0a_A | 288 | Protein (fold bifunctional protein); folate, dehyd | 100.0 | |
| 3ngx_A | 276 | Bifunctional protein fold; methylenetetrahydrofola | 100.0 | |
| 2c2x_A | 281 | Methylenetetrahydrofolate dehydrogenase- methenylt | 100.0 | |
| 1edz_A | 320 | 5,10-methylenetetrahydrofolate dehydrogenase; nucl | 100.0 | |
| 3fbt_A | 282 | Chorismate mutase and shikimate 5-dehydrogenase fu | 100.0 | |
| 3tnl_A | 315 | Shikimate dehydrogenase; structural genomics, cent | 100.0 | |
| 1nyt_A | 271 | Shikimate 5-dehydrogenase; alpha/beta domains, WID | 100.0 | |
| 3jyo_A | 283 | Quinate/shikimate dehydrogenase; enzyme-cofactor c | 100.0 | |
| 1p77_A | 272 | Shikimate 5-dehydrogenase; NADPH, oxidoreductase; | 100.0 | |
| 3don_A | 277 | Shikimate dehydrogenase; alpha-beta structure, ros | 100.0 | |
| 2egg_A | 297 | AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff | 100.0 | |
| 1nvt_A | 287 | Shikimate 5'-dehydrogenase; structural genomics, P | 100.0 | |
| 3pwz_A | 272 | Shikimate dehydrogenase 3; alpha-beta, oxidoreduct | 100.0 | |
| 3t4e_A | 312 | Quinate/shikimate dehydrogenase; structural genomi | 100.0 | |
| 3o8q_A | 281 | Shikimate 5-dehydrogenase I alpha; structural geno | 100.0 | |
| 3tum_A | 269 | Shikimate dehydrogenase family protein; rossmann-f | 100.0 | |
| 2hk9_A | 275 | Shikimate dehydrogenase; shikimate pathway, drug d | 99.98 | |
| 2d5c_A | 263 | AROE, shikimate 5-dehydrogenase; substrate, dimer, | 99.97 | |
| 3phh_A | 269 | Shikimate dehydrogenase; shikimate pathway, helico | 99.97 | |
| 1npy_A | 271 | Hypothetical shikimate 5-dehydrogenase-like protei | 99.97 | |
| 3u62_A | 253 | Shikimate dehydrogenase; shikimate pathway, oxidor | 99.97 | |
| 2o7s_A | 523 | DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat | 99.89 | |
| 2dvm_A | 439 | Malic enzyme, 439AA long hypothetical malate oxido | 99.78 | |
| 1lu9_A | 287 | Methylene tetrahydromethanopterin dehydrogenase; a | 99.71 | |
| 2rir_A | 300 | Dipicolinate synthase, A chain; structural genomic | 99.16 | |
| 3oj0_A | 144 | Glutr, glutamyl-tRNA reductase; structural genomic | 99.09 | |
| 3d4o_A | 293 | Dipicolinate synthase subunit A; NP_243269.1, stru | 99.0 | |
| 1vl6_A | 388 | Malate oxidoreductase; TM0542, NAD-dependent malic | 98.96 | |
| 1pjc_A | 361 | Protein (L-alanine dehydrogenase); oxidoreductase, | 98.95 | |
| 1gpj_A | 404 | Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro | 98.79 | |
| 2a9f_A | 398 | Putative malic enzyme ((S)-malate:NAD+ oxidoreduct | 98.77 | |
| 3h9u_A | 436 | Adenosylhomocysteinase; NAD CO-factor complex, str | 98.73 | |
| 3n58_A | 464 | Adenosylhomocysteinase; ssgcid, hydrolase, structu | 98.64 | |
| 3gvp_A | 435 | Adenosylhomocysteinase 3; protein CO-factor comple | 98.64 | |
| 3p2y_A | 381 | Alanine dehydrogenase/pyridine nucleotide transhy; | 98.64 | |
| 3d64_A | 494 | Adenosylhomocysteinase; structural genomics, ssgci | 98.45 | |
| 4dio_A | 405 | NAD(P) transhydrogenase subunit alpha PART 1; stru | 98.42 | |
| 3jtm_A | 351 | Formate dehydrogenase, mitochondrial; mitochondrio | 98.41 | |
| 3oet_A | 381 | Erythronate-4-phosphate dehydrogenase; structural | 98.4 | |
| 1v8b_A | 479 | Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 | 98.38 | |
| 1l7d_A | 384 | Nicotinamide nucleotide transhydrogenase, subunit | 98.36 | |
| 2axq_A | 467 | Saccharopine dehydrogenase; rossmann fold variant, | 98.35 | |
| 3ond_A | 488 | Adenosylhomocysteinase; plant protein, enzyme-subs | 98.33 | |
| 2g76_A | 335 | 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor | 98.3 | |
| 3k5p_A | 416 | D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, | 98.28 | |
| 4hy3_A | 365 | Phosphoglycerate oxidoreductase; PSI-biology, stru | 98.27 | |
| 3gg9_A | 352 | D-3-phosphoglycerate dehydrogenase oxidoreductase; | 98.27 | |
| 4g2n_A | 345 | D-isomer specific 2-hydroxyacid dehydrogenase, Na; | 98.26 | |
| 1x13_A | 401 | NAD(P) transhydrogenase subunit alpha; NAD(H)-bind | 98.25 | |
| 4dgs_A | 340 | Dehydrogenase; structural genomics, PSI-biology, N | 98.23 | |
| 2cuk_A | 311 | Glycerate dehydrogenase/glyoxylate reductase; stru | 98.21 | |
| 2o4c_A | 380 | Erythronate-4-phosphate dehydrogenase; erythronate | 98.19 | |
| 2z2v_A | 365 | Hypothetical protein PH1688; L-lysine dehydrogenas | 98.16 | |
| 3hg7_A | 324 | D-isomer specific 2-hydroxyacid dehydrogenase FAM | 98.16 | |
| 3pp8_A | 315 | Glyoxylate/hydroxypyruvate reductase A; structural | 98.13 | |
| 3hdj_A | 313 | Probable ornithine cyclodeaminase; APC62486, borde | 98.12 | |
| 2pi1_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 98.12 | |
| 3evt_A | 324 | Phosphoglycerate dehydrogenase; structural genomic | 98.12 | |
| 2vhw_A | 377 | Alanine dehydrogenase; NAD, secreted, oxidoreducta | 98.1 | |
| 3ce6_A | 494 | Adenosylhomocysteinase; protein-substrate complex, | 98.1 | |
| 3gvx_A | 290 | Glycerate dehydrogenase related protein; NYSGXRC, | 98.1 | |
| 1wwk_A | 307 | Phosphoglycerate dehydrogenase; riken structural g | 98.09 | |
| 2dbq_A | 334 | Glyoxylate reductase; D-3-phosphoglycerate dehydro | 98.09 | |
| 1qp8_A | 303 | Formate dehydrogenase; oxidoreductase; HET: NDP; 2 | 98.09 | |
| 2yq5_A | 343 | D-isomer specific 2-hydroxyacid dehydrogenase; oxi | 98.07 | |
| 1xdw_A | 331 | NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas | 98.07 | |
| 4e5n_A | 330 | Thermostable phosphite dehydrogenase; D-2-hydroxya | 98.06 | |
| 2i99_A | 312 | MU-crystallin homolog; thyroid hormine binding pro | 98.05 | |
| 1gdh_A | 320 | D-glycerate dehydrogenase; oxidoreductase(CHOH (D) | 98.05 | |
| 1omo_A | 322 | Alanine dehydrogenase; two-domain, beta-sandwich-d | 98.05 | |
| 2w2k_A | 348 | D-mandelate dehydrogenase; 2-hydroxyacid dehydroge | 98.04 | |
| 2qrj_A | 394 | Saccharopine dehydrogenase, NAD+, L-lysine- formin | 98.04 | |
| 2nac_A | 393 | NAD-dependent formate dehydrogenase; oxidoreductas | 98.02 | |
| 1dxy_A | 333 | D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc | 98.02 | |
| 2ekl_A | 313 | D-3-phosphoglycerate dehydrogenase; structural gen | 98.01 | |
| 1x7d_A | 350 | Ornithine cyclodeaminase; binds NAD+, binds L-orni | 97.99 | |
| 1mx3_A | 347 | CTBP1, C-terminal binding protein 1; nuclear prote | 97.99 | |
| 2j6i_A | 364 | Formate dehydrogenase; oxidoreductase, D-specific- | 97.98 | |
| 3nv9_A | 487 | Malic enzyme; rossmann fold, oxidoreductase; 2.25A | 97.97 | |
| 1ygy_A | 529 | PGDH, D-3-phosphoglycerate dehydrogenase; oxidored | 97.96 | |
| 1j4a_A | 333 | D-LDH, D-lactate dehydrogenase; NAD-dependent dehy | 97.95 | |
| 3ba1_A | 333 | HPPR, hydroxyphenylpyruvate reductase; two domain | 97.94 | |
| 3kb6_A | 334 | D-lactate dehydrogenase; oxidoreductase, D-LDH, NA | 97.92 | |
| 2gcg_A | 330 | Glyoxylate reductase/hydroxypyruvate reductase; NA | 97.88 | |
| 2eez_A | 369 | Alanine dehydrogenase; TTHA0216, structural genomi | 97.86 | |
| 2d0i_A | 333 | Dehydrogenase; structural genomics, NPPSFA, nation | 97.83 | |
| 3abi_A | 365 | Putative uncharacterized protein PH1688; L-lysine | 97.78 | |
| 1sc6_A | 404 | PGDH, D-3-phosphoglycerate dehydrogenase; alloster | 97.78 | |
| 3dtt_A | 245 | NADP oxidoreductase; structural genomics, joint ce | 97.73 | |
| 4dll_A | 320 | 2-hydroxy-3-oxopropionate reductase; structural ge | 97.68 | |
| 3pef_A | 287 | 6-phosphogluconate dehydrogenase, NAD-binding; gam | 97.65 | |
| 3ic5_A | 118 | Putative saccharopine dehydrogenase; structural ge | 97.64 | |
| 2h78_A | 302 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 | 97.64 | |
| 3dfz_A | 223 | SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase | 97.58 | |
| 3doj_A | 310 | AT3G25530, dehydrogenase-like protein; gamma-hydro | 97.58 | |
| 3qha_A | 296 | Putative oxidoreductase; seattle structural genomi | 97.56 | |
| 1ff9_A | 450 | Saccharopine reductase; lysine biosynthesis, alpha | 97.55 | |
| 3pdu_A | 287 | 3-hydroxyisobutyrate dehydrogenase family protein; | 97.51 | |
| 3obb_A | 300 | Probable 3-hydroxyisobutyrate dehydrogenase; struc | 97.5 | |
| 3g0o_A | 303 | 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine | 97.48 | |
| 3l6d_A | 306 | Putative oxidoreductase; structural genomics, prot | 97.46 | |
| 3e8x_A | 236 | Putative NAD-dependent epimerase/dehydratase; stru | 97.45 | |
| 1np3_A | 338 | Ketol-acid reductoisomerase; A DEEP figure-OF-eigh | 97.44 | |
| 4e21_A | 358 | 6-phosphogluconate dehydrogenase (decarboxylating; | 97.42 | |
| 1leh_A | 364 | Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi | 97.38 | |
| 4gbj_A | 297 | 6-phosphogluconate dehydrogenase NAD-binding; stru | 97.37 | |
| 2pv7_A | 298 | T-protein [includes: chorismate mutase (EC 5.4.99 | 97.37 | |
| 4ezb_A | 317 | Uncharacterized conserved protein; structural geno | 97.36 | |
| 3ggo_A | 314 | Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b | 97.36 | |
| 2raf_A | 209 | Putative dinucleotide-binding oxidoreductase; NP_7 | 97.35 | |
| 3qsg_A | 312 | NAD-binding phosphogluconate dehydrogenase-like P; | 97.31 | |
| 2cvz_A | 289 | Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; | 97.3 | |
| 2vns_A | 215 | Metalloreductase steap3; metal-binding, transmembr | 97.27 | |
| 2uyy_A | 316 | N-PAC protein; long-chain dehydrogenase, cytokine; | 97.25 | |
| 2gf2_A | 296 | Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct | 97.2 | |
| 3cky_A | 301 | 2-hydroxymethyl glutarate dehydrogenase; rossmann | 97.18 | |
| 1vpd_A | 299 | Tartronate semialdehyde reductase; structural geno | 97.18 | |
| 2bka_A | 242 | CC3, TAT-interacting protein TIP30; NADPH, PEG600, | 97.13 | |
| 3d1l_A | 266 | Putative NADP oxidoreductase BF3122; structural ge | 97.12 | |
| 2yjz_A | 201 | Metalloreductase steap4; oxidoreductase, metabolic | 96.17 | |
| 3d6n_B | 291 | Aspartate carbamoyltransferase; reactor, chamber, | 97.09 | |
| 1u7z_A | 226 | Coenzyme A biosynthesis bifunctional protein coabc | 97.08 | |
| 1yb4_A | 295 | Tartronic semialdehyde reductase; structural genom | 97.05 | |
| 1hdo_A | 206 | Biliverdin IX beta reductase; foetal metabolism, H | 97.05 | |
| 2g5c_A | 281 | Prephenate dehydrogenase; TYRA, oxidoreductase; HE | 97.02 | |
| 3ruf_A | 351 | WBGU; rossmann fold, UDP-hexose 4-epimerase, isome | 97.02 | |
| 1yqd_A | 366 | Sinapyl alcohol dehydrogenase; lignin, monolignol, | 97.02 | |
| 4h15_A | 261 | Short chain alcohol dehydrogenase-related dehydro; | 97.02 | |
| 3ew7_A | 221 | LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend | 97.0 | |
| 2hmt_A | 144 | YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane | 96.99 | |
| 2zyd_A | 480 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.98 | |
| 2f1k_A | 279 | Prephenate dehydrogenase; tyrosine synthesis, X-RA | 96.97 | |
| 4id9_A | 347 | Short-chain dehydrogenase/reductase; putative dehy | 96.94 | |
| 3dhn_A | 227 | NAD-dependent epimerase/dehydratase; reductase, PF | 96.92 | |
| 1f0y_A | 302 | HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive | 96.91 | |
| 3two_A | 348 | Mannitol dehydrogenase; cinnamyl-alcohol dehydroge | 96.9 | |
| 1c1d_A | 355 | L-phenylalanine dehydrogenase; amino acid dehydrog | 96.9 | |
| 3csu_A | 310 | Protein (aspartate carbamoyltransferase); transfer | 96.9 | |
| 2g1u_A | 155 | Hypothetical protein TM1088A; structural genomics, | 96.88 | |
| 3gt0_A | 247 | Pyrroline-5-carboxylate reductase; structural geno | 96.88 | |
| 4gkb_A | 258 | 3-oxoacyl-[acyl-carrier protein] reductase; putati | 96.87 | |
| 3r6d_A | 221 | NAD-dependent epimerase/dehydratase; structural ge | 96.86 | |
| 2izz_A | 322 | Pyrroline-5-carboxylate reductase 1; amino-acid bi | 96.84 | |
| 3gms_A | 340 | Putative NADPH:quinone reductase; structural genom | 96.84 | |
| 4b79_A | 242 | PA4098, probable short-chain dehydrogenase; oxidor | 96.84 | |
| 4e12_A | 283 | Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 | 96.84 | |
| 2cf5_A | 357 | Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign | 96.83 | |
| 4fs3_A | 256 | Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; | 96.82 | |
| 3r7f_A | 304 | Aspartate carbamoyltransferase; aspartate transcar | 96.82 | |
| 3c24_A | 286 | Putative oxidoreductase; YP_511008.1, structural g | 96.81 | |
| 3dqp_A | 219 | Oxidoreductase YLBE; alpha-beta protein., structur | 96.81 | |
| 1gq2_A | 555 | Malic enzyme; oxidoreductase, pigeon liver, NADP-d | 96.8 | |
| 2pzm_A | 330 | Putative nucleotide sugar epimerase/ dehydratase; | 96.8 | |
| 3tpc_A | 257 | Short chain alcohol dehydrogenase-related dehydro; | 96.8 | |
| 1o5i_A | 249 | 3-oxoacyl-(acyl carrier protein) reductase; TM1169 | 96.79 | |
| 2o23_A | 265 | HADH2 protein; HSD17B10, schad, ERAB, type II HADH | 96.79 | |
| 1o0s_A | 605 | NAD-ME, NAD-dependent malic enzyme; oxidoreductase | 96.78 | |
| 2dpo_A | 319 | L-gulonate 3-dehydrogenase; structural genomics, N | 96.77 | |
| 3llv_A | 141 | Exopolyphosphatase-related protein; NAD(P)-binding | 96.77 | |
| 4g81_D | 255 | Putative hexonate dehydrogenase; enzyme function i | 96.76 | |
| 1jw9_B | 249 | Molybdopterin biosynthesis MOEB protein; MOEB: mod | 96.76 | |
| 1xq6_A | 253 | Unknown protein; structural genomics, protein stru | 96.75 | |
| 2ef0_A | 301 | Ornithine carbamoyltransferase; TTHA1199, thermus | 96.75 | |
| 3rft_A | 267 | Uronate dehydrogenase; apoenzyme, rossmann fold, N | 96.75 | |
| 2ahr_A | 259 | Putative pyrroline carboxylate reductase; pyrrolin | 96.75 | |
| 4fn4_A | 254 | Short chain dehydrogenase; NADH-binding, rossmann | 96.74 | |
| 1duv_G | 333 | Octase-1, ornithine transcarbamoylase; enzyme-inhi | 96.74 | |
| 3c85_A | 183 | Putative glutathione-regulated potassium-efflux S | 96.74 | |
| 1pvv_A | 315 | Otcase, ornithine carbamoyltransferase; dodecamer; | 96.74 | |
| 3qvo_A | 236 | NMRA family protein; structural genomics, PSI-biol | 96.74 | |
| 1txg_A | 335 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid | 96.74 | |
| 4eye_A | 342 | Probable oxidoreductase; structural genomics, niai | 96.72 | |
| 3sxp_A | 362 | ADP-L-glycero-D-mannoheptose-6-epimerase; rossman | 96.71 | |
| 3tzq_B | 271 | Short-chain type dehydrogenase/reductase; ssgcid, | 96.71 | |
| 3pid_A | 432 | UDP-glucose 6-dehydrogenase; rossmann fold, oxidor | 96.7 | |
| 1pg5_A | 299 | Aspartate carbamoyltransferase; 2.60A {Sulfolobus | 96.7 | |
| 3vtz_A | 269 | Glucose 1-dehydrogenase; rossmann fold, oxidoreduc | 96.69 | |
| 3tpf_A | 307 | Otcase, ornithine carbamoyltransferase; structural | 96.69 | |
| 1iz0_A | 302 | Quinone oxidoreductase; APO-enzyme, riken structur | 96.69 | |
| 3afn_B | 258 | Carbonyl reductase; alpha/beta/alpha, rossmann-fol | 96.69 | |
| 3h2s_A | 224 | Putative NADH-flavin reductase; Q03B84, NESG, LCR1 | 96.68 | |
| 3m2p_A | 311 | UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J | 96.68 | |
| 3ojo_A | 431 | CAP5O; rossmann fold, complex with cofactor NAD an | 96.68 | |
| 3tqh_A | 321 | Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella | 96.68 | |
| 4gwg_A | 484 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.67 | |
| 3jyn_A | 325 | Quinone oxidoreductase; rossmann fold, protein-NAD | 96.65 | |
| 4a7p_A | 446 | UDP-glucose dehydrogenase; oxidoreductase, carbohy | 96.65 | |
| 1uuf_A | 369 | YAHK, zinc-type alcohol dehydrogenase-like protein | 96.64 | |
| 1lss_A | 140 | TRK system potassium uptake protein TRKA homolog; | 96.63 | |
| 3gg2_A | 450 | Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd | 96.62 | |
| 2i6u_A | 307 | Otcase, ornithine carbamoyltransferase; X-RAY crys | 96.62 | |
| 4ekn_B | 306 | Aspartate carbamoyltransferase; atcase, aspartate | 96.61 | |
| 4e6p_A | 259 | Probable sorbitol dehydrogenase (L-iditol 2-dehyd; | 96.61 | |
| 2gas_A | 307 | Isoflavone reductase; NADPH-dependent reductase, o | 96.6 | |
| 3uxy_A | 266 | Short-chain dehydrogenase/reductase SDR; structura | 96.6 | |
| 1dxh_A | 335 | Ornithine carbamoyltransferase; transcarbamylase; | 96.59 | |
| 2p4q_A | 497 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.59 | |
| 4a8t_A | 339 | Putrescine carbamoyltransferase; trabnsferase PALO | 96.58 | |
| 4b7c_A | 336 | Probable oxidoreductase; NADP cofactor, rossmann f | 96.58 | |
| 3g79_A | 478 | NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; | 96.58 | |
| 4huj_A | 220 | Uncharacterized protein; PSI-biology, nysgrc, stru | 96.58 | |
| 1z82_A | 335 | Glycerol-3-phosphate dehydrogenase; TM0378, struct | 96.56 | |
| 3gd5_A | 323 | Otcase, ornithine carbamoyltransferase; structural | 96.56 | |
| 1vlv_A | 325 | Otcase, ornithine carbamoyltransferase; TM1097, st | 96.56 | |
| 2vn8_A | 375 | Reticulon-4-interacting protein 1; mitochondrion, | 96.55 | |
| 3rwb_A | 247 | TPLDH, pyridoxal 4-dehydrogenase; short chain dehy | 96.55 | |
| 1piw_A | 360 | Hypothetical zinc-type alcohol dehydrogenase- like | 96.55 | |
| 3qwb_A | 334 | Probable quinone oxidoreductase; rossmann fold, qu | 96.55 | |
| 2dtx_A | 264 | Glucose 1-dehydrogenase related protein; rossmann | 96.54 | |
| 2q3e_A | 467 | UDP-glucose 6-dehydrogenase; hexamer, structural g | 96.53 | |
| 3oh8_A | 516 | Nucleoside-diphosphate sugar epimerase (SULA FAMI; | 96.52 | |
| 3lk7_A | 451 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; a | 96.52 | |
| 2iz1_A | 474 | 6-phosphogluconate dehydrogenase, decarboxylating; | 96.52 | |
| 4f2g_A | 309 | Otcase 1, ornithine carbamoyltransferase 1; struct | 96.51 | |
| 2gk4_A | 232 | Conserved hypothetical protein; alpha-beta-alpha s | 96.51 | |
| 2q1s_A | 377 | Putative nucleotide sugar epimerase/ dehydratase; | 96.51 | |
| 3gem_A | 260 | Short chain dehydrogenase; structural genomics, AP | 96.51 | |
| 1pjq_A | 457 | CYSG, siroheme synthase; rossman fold, nucleotide | 96.5 | |
| 3b1f_A | 290 | Putative prephenate dehydrogenase; enzyme, 4-hydro | 96.5 | |
| 3i6i_A | 346 | Putative leucoanthocyanidin reductase 1; rossmann | 96.5 | |
| 4ina_A | 405 | Saccharopine dehydrogenase; structural genomics, P | 96.49 | |
| 3n74_A | 261 | 3-ketoacyl-(acyl-carrier-protein) reductase; seatt | 96.48 | |
| 3c1o_A | 321 | Eugenol synthase; phenylpropene, PIP reductase, sh | 96.48 | |
| 1rjw_A | 339 | ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD | 96.48 | |
| 1nff_A | 260 | Putative oxidoreductase RV2002; directed evolution | 96.48 | |
| 1ml4_A | 308 | Aspartate transcarbamoylase; beta pleated sheet, p | 96.48 | |
| 3qiv_A | 253 | Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR | 96.48 | |
| 2ew2_A | 316 | 2-dehydropantoate 2-reductase, putative; alpha-str | 96.48 | |
| 1kyq_A | 274 | Met8P, siroheme biosynthesis protein Met8; homodim | 96.48 | |
| 4a8p_A | 355 | Putrescine carbamoyltransferase; ornithine agmatin | 96.47 | |
| 3uog_A | 363 | Alcohol dehydrogenase; structural genomics, protei | 96.47 | |
| 2a4k_A | 263 | 3-oxoacyl-[acyl carrier protein] reductase; reduct | 96.47 | |
| 3d7l_A | 202 | LIN1944 protein; APC89317, structural genomics, PS | 96.47 | |
| 2hcy_A | 347 | Alcohol dehydrogenase 1; tetramer of asymmetric di | 96.47 | |
| 3sds_A | 353 | Ornithine carbamoyltransferase, mitochondrial; str | 96.46 | |
| 1zej_A | 293 | HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural | 96.45 | |
| 2q1w_A | 333 | Putative nucleotide sugar epimerase/ dehydratase; | 96.45 | |
| 2nm0_A | 253 | Probable 3-oxacyl-(acyl-carrier-protein) reductas; | 96.45 | |
| 1sb8_A | 352 | WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN | 96.45 | |
| 4iin_A | 271 | 3-ketoacyl-acyl carrier protein reductase (FABG); | 96.44 | |
| 1ae1_A | 273 | Tropinone reductase-I; oxidoreductase, tropane alk | 96.44 | |
| 3ijr_A | 291 | Oxidoreductase, short chain dehydrogenase/reducta; | 96.42 | |
| 1yqg_A | 263 | Pyrroline-5-carboxylate reductase; structural geno | 96.41 | |
| 4ep1_A | 340 | Otcase, ornithine carbamoyltransferase; structural | 96.41 | |
| 1pj3_A | 564 | NAD-dependent malic enzyme, mitochondrial; oxidati | 96.41 | |
| 3vps_A | 321 | TUNA, NAD-dependent epimerase/dehydratase; tunicam | 96.41 | |
| 1pqw_A | 198 | Polyketide synthase; rossmann fold, dimer, structu | 96.4 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 96.4 | |
| 3op4_A | 248 | 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto | 96.4 | |
| 4fgs_A | 273 | Probable dehydrogenase protein; PSI-biology, nysgr | 96.4 | |
| 3h5n_A | 353 | MCCB protein; ubiquitin-activating enzyme, microci | 96.39 | |
| 1e6u_A | 321 | GDP-fucose synthetase; epimerase/reductase, SDR, R | 96.39 | |
| 3un1_A | 260 | Probable oxidoreductase; structural genomics, PSI- | 96.39 | |
| 3imf_A | 257 | Short chain dehydrogenase; structural genomics, in | 96.39 | |
| 1ooe_A | 236 | Dihydropteridine reductase; structural genomics, P | 96.38 | |
| 3f9i_A | 249 | 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto | 96.38 | |
| 2c5a_A | 379 | GDP-mannose-3', 5'-epimerase; short chain dehydrat | 96.38 | |
| 2b4q_A | 276 | Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier | 96.38 | |
| 1ks9_A | 291 | KPA reductase;, 2-dehydropantoate 2-reductase; PAN | 96.38 | |
| 4dup_A | 353 | Quinone oxidoreductase; PSI-biology, structural ge | 96.37 | |
| 1vl0_A | 292 | DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s | 96.37 | |
| 4dqx_A | 277 | Probable oxidoreductase protein; structural genomi | 96.37 | |
| 3sc4_A | 285 | Short chain dehydrogenase (A0QTM2 homolog); ssgcid | 96.36 | |
| 4egf_A | 266 | L-xylulose reductase; structural genomics, ssgcid, | 96.36 | |
| 4b4o_A | 298 | Epimerase family protein SDR39U1; isomerase; HET: | 96.36 | |
| 1v3u_A | 333 | Leukotriene B4 12- hydroxydehydrogenase/prostaglan | 96.36 | |
| 1bg6_A | 359 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L | 96.36 | |
| 3zv4_A | 281 | CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox | 96.36 | |
| 1id1_A | 153 | Putative potassium channel protein; RCK domain, E. | 96.35 | |
| 3grp_A | 266 | 3-oxoacyl-(acyl carrierprotein) reductase; structu | 96.35 | |
| 2p4h_X | 322 | Vestitone reductase; NADPH-dependent reductase, is | 96.35 | |
| 3v2g_A | 271 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 96.35 | |
| 3gvc_A | 277 | Oxidoreductase, probable short-chain type dehydrog | 96.34 | |
| 1y1p_A | 342 | ARII, aldehyde reductase II; rossmann fold, short | 96.33 | |
| 2w37_A | 359 | Ornithine carbamoyltransferase, catabolic; transca | 96.33 | |
| 3uce_A | 223 | Dehydrogenase; rossmann fold, oxidoreductase; HET: | 96.33 | |
| 2r6j_A | 318 | Eugenol synthase 1; phenylpropene, PIP reductase, | 96.33 | |
| 3gaf_A | 256 | 7-alpha-hydroxysteroid dehydrogenase; seattle stru | 96.32 | |
| 1wly_A | 333 | CAAR, 2-haloacrylate reductase; NADPH-dependent ox | 96.32 | |
| 2ydy_A | 315 | Methionine adenosyltransferase 2 subunit beta; oxi | 96.32 | |
| 1oth_A | 321 | Protein (ornithine transcarbamoylase); transferase | 96.31 | |
| 2c0c_A | 362 | Zinc binding alcohol dehydrogenase, domain contain | 96.31 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 96.31 | |
| 2z1m_A | 345 | GDP-D-mannose dehydratase; short-chain dehydrogena | 96.31 | |
| 3v2h_A | 281 | D-beta-hydroxybutyrate dehydrogenase; structural g | 96.3 | |
| 1x0v_A | 354 | GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase | 96.29 | |
| 3tl3_A | 257 | Short-chain type dehydrogenase/reductase; ssgcid, | 96.29 | |
| 2gn4_A | 344 | FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann | 96.29 | |
| 3l77_A | 235 | Short-chain alcohol dehydrogenase; oxidoreductase; | 96.29 | |
| 1qyc_A | 308 | Phenylcoumaran benzylic ether reductase PT1; NADPH | 96.29 | |
| 3rkr_A | 262 | Short chain oxidoreductase; rossmann fold; HET: NA | 96.28 | |
| 4dmm_A | 269 | 3-oxoacyl-[acyl-carrier-protein] reductase; rossma | 96.28 | |
| 4h31_A | 358 | Otcase, ornithine carbamoyltransferase; structural | 96.26 | |
| 3orf_A | 251 | Dihydropteridine reductase; alpha-beta-alpha sandw | 96.26 | |
| 3ius_A | 286 | Uncharacterized conserved protein; APC63810, silic | 96.26 | |
| 3tjr_A | 301 | Short chain dehydrogenase; structural genomics, se | 96.25 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 96.25 | |
| 3ucx_A | 264 | Short chain dehydrogenase; ssgcid, seattle structu | 96.24 | |
| 1jvb_A | 347 | NAD(H)-dependent alcohol dehydrogenase; archaeon, | 96.23 | |
| 4ibo_A | 271 | Gluconate dehydrogenase; enzyme function initiativ | 96.22 | |
| 1mv8_A | 436 | GMD, GDP-mannose 6-dehydrogenase; rossman fold, do | 96.2 | |
| 3vtf_A | 444 | UDP-glucose 6-dehydrogenase; two discrete alpha/be | 96.2 | |
| 3tri_A | 280 | Pyrroline-5-carboxylate reductase; amino acid bios | 96.19 | |
| 3ko8_A | 312 | NAD-dependent epimerase/dehydratase; isomerase, UD | 96.19 | |
| 1yj8_A | 375 | Glycerol-3-phosphate dehydrogenase; SGPP, structur | 96.19 | |
| 4da9_A | 280 | Short-chain dehydrogenase/reductase; structural ge | 96.18 | |
| 1uay_A | 242 | Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid | 96.18 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 96.18 | |
| 3m1a_A | 281 | Putative dehydrogenase; short, PSI, MCSG, structur | 96.17 | |
| 3fwz_A | 140 | Inner membrane protein YBAL; TRKA-N domain, E.coli | 96.16 | |
| 3k6j_A | 460 | Protein F01G10.3, confirmed by transcript evidenc; | 96.16 | |
| 3s2e_A | 340 | Zinc-containing alcohol dehydrogenase superfamily; | 96.16 | |
| 2x6t_A | 357 | ADP-L-glycero-D-manno-heptose-6-epimerase; isomera | 96.15 | |
| 3is3_A | 270 | 17BETA-hydroxysteroid dehydrogenase; short chain d | 96.15 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 96.14 | |
| 3v8b_A | 283 | Putative dehydrogenase, possibly 3-oxoacyl-[acyl- | 96.14 | |
| 3gpi_A | 286 | NAD-dependent epimerase/dehydratase; structural ge | 96.14 | |
| 2dkn_A | 255 | 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta | 96.13 | |
| 3grk_A | 293 | Enoyl-(acyl-carrier-protein) reductase (NADH); ssg | 96.13 | |
| 3st7_A | 369 | Capsular polysaccharide synthesis enzyme CAP5F; ro | 96.13 | |
| 3ftp_A | 270 | 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid | 96.12 | |
| 3fr7_A | 525 | Putative ketol-acid reductoisomerase (OS05G057370 | 96.11 | |
| 2pgd_A | 482 | 6-phosphogluconate dehydrogenase; oxidoreductase ( | 96.11 | |
| 3p19_A | 266 | BFPVVD8, putative blue fluorescent protein; rossma | 96.11 | |
| 3sc6_A | 287 | DTDP-4-dehydrorhamnose reductase; RFBD, structural | 96.11 | |
| 1sny_A | 267 | Sniffer CG10964-PA; alpha and beta protein, rossma | 96.1 | |
| 3tox_A | 280 | Short chain dehydrogenase; structural genomics, PS | 96.1 | |
| 3tfo_A | 264 | Putative 3-oxoacyl-(acyl-carrier-protein) reducta; | 96.09 | |
| 3hwr_A | 318 | 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A | 96.09 | |
| 1fjh_A | 257 | 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc | 96.09 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 96.08 | |
| 3h7a_A | 252 | Short chain dehydrogenase; oxidoreductase, PSI-2, | 96.08 | |
| 1qyd_A | 313 | Pinoresinol-lariciresinol reductase; NADPH-depende | 96.07 | |
| 3gqv_A | 371 | Enoyl reductase; medium-chain reductase (MDR super | 96.06 | |
| 3k31_A | 296 | Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI | 96.05 | |
| 1yb5_A | 351 | Quinone oxidoreductase; medium-chain dehydrogenase | 96.04 | |
| 3enk_A | 341 | UDP-glucose 4-epimerase; seattle structural genomi | 96.04 | |
| 2a35_A | 215 | Hypothetical protein PA4017; alpha-beta-alpha sand | 96.04 | |
| 2ehd_A | 234 | Oxidoreductase, oxidoreductase, short-chain dehydr | 96.03 | |
| 2hrz_A | 342 | AGR_C_4963P, nucleoside-diphosphate-sugar epimeras | 96.02 | |
| 2rcy_A | 262 | Pyrroline carboxylate reductase; malaria, structur | 96.02 | |
| 4dyv_A | 272 | Short-chain dehydrogenase/reductase SDR; structura | 96.02 | |
| 3rd5_A | 291 | Mypaa.01249.C; ssgcid, structural genomics, seattl | 96.01 | |
| 2h6e_A | 344 | ADH-4, D-arabinose 1-dehydrogenase; rossman fold, | 96.01 | |
| 2ekp_A | 239 | 2-deoxy-D-gluconate 3-dehydrogenase; structural ge | 96.01 | |
| 3e03_A | 274 | Short chain dehydrogenase; structural genomics, PS | 96.01 | |
| 2wm3_A | 299 | NMRA-like family domain containing protein 1; unkn | 96.01 | |
| 3r1i_A | 276 | Short-chain type dehydrogenase/reductase; structur | 96.0 | |
| 1hdc_A | 254 | 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi | 96.0 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 95.99 | |
| 2c29_D | 337 | Dihydroflavonol 4-reductase; flavonoids, short deh | 95.99 | |
| 3dii_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.98 | |
| 1zsy_A | 357 | Mitochondrial 2-enoyl thioester reductase; medium- | 95.98 | |
| 1qor_A | 327 | Quinone oxidoreductase; HET: NAP; 2.20A {Escherich | 95.98 | |
| 2d8a_A | 348 | PH0655, probable L-threonine 3-dehydrogenase; pyro | 95.97 | |
| 2j8z_A | 354 | Quinone oxidoreductase; medium-chain dehydrogenase | 95.96 | |
| 1rkx_A | 357 | CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; | 95.94 | |
| 3sju_A | 279 | Keto reductase; short-chain dehydrogenase, oxidore | 95.93 | |
| 1cyd_A | 244 | Carbonyl reductase; short-chain dehydrogenase, oxi | 95.93 | |
| 3goh_A | 315 | Alcohol dehydrogenase, zinc-containing; NP_718042. | 95.93 | |
| 2b69_A | 343 | UDP-glucuronate decarboxylase 1; UDP-glucoronic ac | 95.93 | |
| 4imr_A | 275 | 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor | 95.92 | |
| 3nrc_A | 280 | Enoyl-[acyl-carrier-protein] reductase (NADH); ros | 95.92 | |
| 3nx4_A | 324 | Putative oxidoreductase; csgid, structural genomic | 95.91 | |
| 3nzo_A | 399 | UDP-N-acetylglucosamine 4,6-dehydratase; structura | 95.91 | |
| 2pk3_A | 321 | GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor | 95.9 | |
| 1p0f_A | 373 | NADP-dependent alcohol dehydrogenase; ADH topology | 95.9 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 95.89 | |
| 3pi7_A | 349 | NADH oxidoreductase; groes-like fold, NAD(P)-bindi | 95.89 | |
| 3grf_A | 328 | Ornithine carbamoyltransferase; ornithine transcar | 95.89 | |
| 3k96_A | 356 | Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA | 95.88 | |
| 1h5q_A | 265 | NADP-dependent mannitol dehydrogenase; oxidoreduct | 95.88 | |
| 1cdo_A | 374 | Alcohol dehydrogenase; oxidoreductase, oxidoreduct | 95.87 | |
| 2jhf_A | 374 | Alcohol dehydrogenase E chain; oxidoreductase, met | 95.86 | |
| 4hp8_A | 247 | 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi | 95.86 | |
| 3rih_A | 293 | Short chain dehydrogenase or reductase; structural | 95.84 | |
| 2wsb_A | 254 | Galactitol dehydrogenase; oxidoreductase, SDR, ros | 95.84 | |
| 3e9n_A | 245 | Putative short-chain dehydrogenase/reductase; stru | 95.82 | |
| 3d3w_A | 244 | L-xylulose reductase; uronate cycle, short-chain d | 95.82 | |
| 4f6c_A | 427 | AUSA reductase domain protein; thioester reductase | 95.82 | |
| 2eih_A | 343 | Alcohol dehydrogenase; zinc ION binding protein, s | 95.82 | |
| 2rh8_A | 338 | Anthocyanidin reductase; flavonoids, rossmann fold | 95.82 | |
| 1i36_A | 264 | Conserved hypothetical protein MTH1747; NADP bindi | 95.81 | |
| 2x4g_A | 342 | Nucleoside-diphosphate-sugar epimerase; isomerase; | 95.81 | |
| 4amu_A | 365 | Ornithine carbamoyltransferase, catabolic; ornithi | 95.81 | |
| 3uko_A | 378 | Alcohol dehydrogenase class-3; alcohol dehydrogena | 95.81 | |
| 3osu_A | 246 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.79 | |
| 3ai3_A | 263 | NADPH-sorbose reductase; rossmann-fold, NADPH-depe | 95.79 | |
| 3fpc_A | 352 | NADP-dependent alcohol dehydrogenase; oxydoreducta | 95.78 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 95.76 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 95.76 | |
| 2x5o_A | 439 | UDP-N-acetylmuramoylalanine--D-glutamate ligase; A | 95.75 | |
| 1e3i_A | 376 | Alcohol dehydrogenase, class II; HET: NAD; 2.08A { | 95.75 | |
| 3i83_A | 320 | 2-dehydropantoate 2-reductase; structural genomics | 95.75 | |
| 3ay3_A | 267 | NAD-dependent epimerase/dehydratase; glucuronic ac | 95.74 | |
| 3i4f_A | 264 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 95.74 | |
| 3lf2_A | 265 | Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross | 95.74 | |
| 3awd_A | 260 | GOX2181, putative polyol dehydrogenase; oxidoreduc | 95.74 | |
| 2dc1_A | 236 | L-aspartate dehydrogenase; NAD, oxidoreductase; HE | 95.73 | |
| 3ak4_A | 263 | NADH-dependent quinuclidinone reductase; SDR, (R)- | 95.73 | |
| 1vl8_A | 267 | Gluconate 5-dehydrogenase; TM0441, structural geno | 95.73 | |
| 1pgj_A | 478 | 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; o | 95.73 | |
| 1uzm_A | 247 | 3-oxoacyl-[acyl-carrier protein] reductase; beta-k | 95.72 | |
| 1ek6_A | 348 | UDP-galactose 4-epimerase; short-chain dehydrogena | 95.71 | |
| 3ged_A | 247 | Short-chain dehydrogenase/reductase SDR; SCOR, ros | 95.7 | |
| 2ae2_A | 260 | Protein (tropinone reductase-II); oxidoreductase, | 95.7 | |
| 4eso_A | 255 | Putative oxidoreductase; NADP, structural genomics | 95.7 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 95.7 | |
| 1oc2_A | 348 | DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos | 95.69 | |
| 2fzw_A | 373 | Alcohol dehydrogenase class III CHI chain; S-nitro | 95.69 | |
| 3ado_A | 319 | Lambda-crystallin; L-gulonate 3-dehydrogenase, str | 95.69 | |
| 2pnf_A | 248 | 3-oxoacyl-[acyl-carrier-protein] reductase; short | 95.69 | |
| 1rpn_A | 335 | GDP-mannose 4,6-dehydratase; short-chain dehydroge | 95.68 | |
| 2c20_A | 330 | UDP-glucose 4-epimerase; carbohydrate metabolism, | 95.68 | |
| 1jay_A | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma | 95.68 | |
| 2v6g_A | 364 | Progesterone 5-beta-reductase; tyrosine-dependent | 95.67 | |
| 2jl1_A | 287 | Triphenylmethane reductase; oxidoreductase, biorem | 95.67 | |
| 2fwm_X | 250 | 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e | 95.67 | |
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 95.67 | |
| 2pd6_A | 264 | Estradiol 17-beta-dehydrogenase 8; short-chain deh | 95.66 | |
| 3f1l_A | 252 | Uncharacterized oxidoreductase YCIK; E. coli, NADP | 95.65 | |
| 3ppi_A | 281 | 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de | 95.65 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 95.65 | |
| 1uls_A | 245 | Putative 3-oxoacyl-acyl carrier protein reductase; | 95.65 | |
| 2d1y_A | 256 | Hypothetical protein TT0321; strucrtural genomics, | 95.64 | |
| 2jah_A | 247 | Clavulanic acid dehydrogenase; short-chain dehydro | 95.64 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 95.64 | |
| 3pk0_A | 262 | Short-chain dehydrogenase/reductase SDR; ssgcid, s | 95.64 | |
| 3svt_A | 281 | Short-chain type dehydrogenase/reductase; ssgcid, | 95.63 | |
| 3i1j_A | 247 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.63 | |
| 1fmc_A | 255 | 7 alpha-hydroxysteroid dehydrogenase; short-chain | 95.63 | |
| 3s55_A | 281 | Putative short-chain dehydrogenase/reductase; stru | 95.61 | |
| 3eag_A | 326 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME | 95.61 | |
| 3oig_A | 266 | Enoyl-[acyl-carrier-protein] reductase [NADH]; fat | 95.61 | |
| 3aoe_E | 419 | Glutamate dehydrogenase; rossmann fold, NADH, oxid | 95.6 | |
| 2ew8_A | 249 | (S)-1-phenylethanol dehydrogenase; transferase; 2. | 95.6 | |
| 2z1n_A | 260 | Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 | 95.6 | |
| 1yb1_A | 272 | 17-beta-hydroxysteroid dehydrogenase type XI; shor | 95.6 | |
| 3ctm_A | 279 | Carbonyl reductase; alcohol dehydrogenase, short-c | 95.6 | |
| 3oid_A | 258 | Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa | 95.59 | |
| 4ej6_A | 370 | Putative zinc-binding dehydrogenase; structural ge | 95.59 | |
| 1zk4_A | 251 | R-specific alcohol dehydrogenase; short chain redu | 95.58 | |
| 4iiu_A | 267 | 3-oxoacyl-[acyl-carrier protein] reductase; struct | 95.58 | |
| 3e48_A | 289 | Putative nucleoside-diphosphate-sugar epimerase; a | 95.58 | |
| 2q2v_A | 255 | Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore | 95.57 | |
| 2yy7_A | 312 | L-threonine dehydrogenase; thermolabIle, flavobact | 95.57 | |
| 1iy8_A | 267 | Levodione reductase; oxidoreductase; HET: NAD; 1.6 | 95.56 | |
| 3pxx_A | 287 | Carveol dehydrogenase; structural genomics, seattl | 95.56 | |
| 2ag5_A | 246 | DHRS6, dehydrogenase/reductase (SDR family) member | 95.56 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 95.54 | |
| 1xg5_A | 279 | ARPG836; short chain dehydrogenase, human, SGC, st | 95.53 | |
| 1zem_A | 262 | Xylitol dehydrogenase; rossmann fold, dinucleotide | 95.53 | |
| 4egb_A | 346 | DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce | 95.53 | |
| 3u5t_A | 267 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.53 | |
| 2zat_A | 260 | Dehydrogenase/reductase SDR family member 4; alpha | 95.52 | |
| 3gaz_A | 343 | Alcohol dehydrogenase superfamily protein; oxidore | 95.51 | |
| 3uf0_A | 273 | Short-chain dehydrogenase/reductase SDR; gluconate | 95.51 | |
| 1evy_A | 366 | Glycerol-3-phosphate dehydrogenase; rossmann fold, | 95.51 | |
| 4dqv_A | 478 | Probable peptide synthetase NRP (peptide synthase; | 95.51 | |
| 2bgk_A | 278 | Rhizome secoisolariciresinol dehydrogenase; oxidor | 95.51 | |
| 3l4b_C | 218 | TRKA K+ channel protien TM1088B; potassium channel | 95.5 | |
| 1y81_A | 138 | Conserved hypothetical protein; hyperthermophIle, | 95.5 | |
| 3sx2_A | 278 | Putative 3-ketoacyl-(acyl-carrier-protein) reduct; | 95.49 | |
| 3mog_A | 483 | Probable 3-hydroxybutyryl-COA dehydrogenase; struc | 95.49 | |
| 4fc7_A | 277 | Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman | 95.48 | |
| 2hq1_A | 247 | Glucose/ribitol dehydrogenase; CTH-1438, structura | 95.48 | |
| 1yde_A | 270 | Retinal dehydrogenase/reductase 3; oxidoreductase, | 95.47 | |
| 2rhc_B | 277 | Actinorhodin polyketide ketoreductase; oxidoreduct | 95.47 | |
| 1w6u_A | 302 | 2,4-dienoyl-COA reductase, mitochondrial precursor | 95.47 | |
| 1hxh_A | 253 | 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b | 95.46 | |
| 3gk3_A | 269 | Acetoacetyl-COA reductase; acetoacetyl-CO reductas | 95.44 | |
| 3tz6_A | 344 | Aspartate-semialdehyde dehydrogenase; asadh, ASD, | 95.44 | |
| 3fbg_A | 346 | Putative arginate lyase; structural genomics, unkn | 95.44 | |
| 1yxm_A | 303 | Pecra, peroxisomal trans 2-enoyl COA reductase; pe | 95.43 | |
| 3ghy_A | 335 | Ketopantoate reductase protein; oxidoreductase, NA | 95.42 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 95.41 | |
| 3lyl_A | 247 | 3-oxoacyl-(acyl-carrier-protein) reductase; alpha | 95.41 | |
| 2cdc_A | 366 | Glucose dehydrogenase glucose 1-dehydrogenase, DHG | 95.4 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 95.4 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 95.4 | |
| 1n2s_A | 299 | DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold | 95.4 | |
| 3l6e_A | 235 | Oxidoreductase, short-chain dehydrogenase/reducta; | 95.39 | |
| 3t4x_A | 267 | Oxidoreductase, short chain dehydrogenase/reducta; | 95.38 | |
| 4dry_A | 281 | 3-oxoacyl-[acyl-carrier-protein] reductase; struct | 95.37 | |
| 1x1t_A | 260 | D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S | 95.37 | |
| 1dhr_A | 241 | Dihydropteridine reductase; oxidoreductase(acting | 95.37 | |
| 2hun_A | 336 | 336AA long hypothetical DTDP-glucose 4,6-dehydrat; | 95.37 | |
| 1xq1_A | 266 | Putative tropinone reducatse; structural genomics, | 95.37 | |
| 1sby_A | 254 | Alcohol dehydrogenase; ternary complex, NAD, trifl | 95.36 | |
| 2gdz_A | 267 | NAD+-dependent 15-hydroxyprostaglandin dehydrogen; | 95.36 | |
| 3pgx_A | 280 | Carveol dehydrogenase; structural genomics, seattl | 95.35 | |
| 2zcu_A | 286 | Uncharacterized oxidoreductase YTFG; alpha-beta sa | 95.34 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 95.34 | |
| 3aog_A | 440 | Glutamate dehydrogenase; NAD(H), oxidoreducta; HET | 95.33 |
| >4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-82 Score=574.78 Aligned_cols=256 Identities=42% Similarity=0.718 Sum_probs=249.2
Q ss_pred CCCCCCCeEEEEEeCCCcchHHHHHHHHHHHHHcCCeEEEEEcCCCCCHHHHHHHHHhhhcCCCcCEEEEeCCCCCCCCH
Q 024282 3 KSIGKVPGLAVILVGERRDSQTYVRNKIKACEEVGIKSIVTEFADGCTEDEVLNALSNYNQDSSINGILVQLPLPQHLDE 82 (269)
Q Consensus 3 ~~~~~~p~L~~i~vg~~~~s~~y~~~~~~~~~~~Gi~~~~~~~~~~~~~~~l~~~i~~ln~d~~v~Gi~V~~Pl~~~~~~ 82 (269)
++.|++|+||+|+||+||+|.+|+++|.|+|+++||+++.+.||++++|+||++.|++||+|++||||+||+|||+|+++
T Consensus 48 ~~~g~~P~LavIlVG~dpaS~~Yv~~K~k~c~~vGi~s~~~~lp~~~se~ell~~I~~LN~D~~V~GIlVQlPLP~hid~ 127 (303)
T 4b4u_A 48 AKTGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDE 127 (303)
T ss_dssp HHHSCCCEEEEEEESCCHHHHHHHHHHHHHHHHTTCEEEEEEECTTCCHHHHHHHHHHHHTCTTCCEEEECSSCCTTSCH
T ss_pred HcCCCCCcEEEEEeCCCHHHHHHHHHHHHHHHHcCCeEEEEecCccCCHHHHHHHHHHhcCCCCccEEEEeCCCccccCh
Confidence 45689999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHhcCCccccccccccceecccccCCCCCccccCCHHHHHHHHHHhCCCCccceEEEEcCCcccHHHHHHHHHhCCCE
Q 024282 83 GKILDAVSLEKDVDGFHPLNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHAT 162 (269)
Q Consensus 83 ~~i~~~i~p~kdvdg~~~~n~g~l~~g~~~~~~~p~t~~g~~~~l~~~~~~l~gk~v~ViG~gg~vg~~~a~~L~~~ga~ 162 (269)
.+++++|+|+|||||||+.|.|+|+.| .+.|+||||.|++++|++|+++++||+++|||||..||||++.+|.++||+
T Consensus 128 ~~i~~~I~p~KDVDG~hp~N~G~L~~g--~~~~~PcTp~gv~~lL~~~~i~l~Gk~vvViGRS~iVGkPla~LL~~~~AT 205 (303)
T 4b4u_A 128 RACFDAISLAKDVDGVTCLGFGRMAMG--EAAYGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANAT 205 (303)
T ss_dssp HHHHHHSCGGGCTTCCCHHHHHHHHTT--CCCCCCHHHHHHHHHHHHTTCCCTTCEEEEECCCTTTHHHHHHHHHHTTCE
T ss_pred HHHHhccCcccccCccCcchHHHhcCC--CCcccCccHHHHHHHHHHHCCCCCCCEEEEEeccccccchHHHHHHhcCCE
Confidence 999999999999999999999999976 678999999999999999999999999999999999999999999999999
Q ss_pred EEEEeCCCCCHhhhcCCCCEEEeccCCCCcccCCCcCCCcEEEEeeecCCCCCCCCCCceeecccchHHHhhHcceeccc
Q 024282 163 VSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVITPV 242 (269)
Q Consensus 163 Vti~~~~t~~l~~~~~~aDiVIsAtg~p~~i~~~~~~~g~vViDv~~~~~~~~~~~~~~~l~GDvd~~~~~~~~~~~tpv 242 (269)
||+||++|+++.+++++|||||+|+|+|++++++|+|+|++|||+|+|+.++ +++|||||++++++++++|||
T Consensus 206 VTi~Hs~T~dl~~~~~~ADIvV~A~G~p~~i~~d~vk~GavVIDVGin~~~~-------~~vGDVdf~~v~~~a~~iTPV 278 (303)
T 4b4u_A 206 VTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPRDG-------GGVGDIQLQGIEEIASAYTPV 278 (303)
T ss_dssp EEEECTTCSSHHHHHHTCSEEEECSCSTTCBCGGGSCTTCEEEECCCBCCTT-------SCBCSBCCTTGGGTCSEECCS
T ss_pred EEEecCCCCCHHHHhhcCCeEEeccCCCCccccccccCCCEEEEeceecCCC-------CeECCcCHHHHhhhCcEECCC
Confidence 9999999999999999999999999999999999999999999999998654 799999999999999999999
Q ss_pred CCcccHHHHHHHHHHHHHHHHHHhC
Q 024282 243 PGGVGPMTVAMLLSNTLDSAKRAYG 267 (269)
Q Consensus 243 pgGvGp~T~~mLl~n~v~a~~~~~~ 267 (269)
||||||||++|||+|+++|+|+.+|
T Consensus 279 PGGVGPmTiamLl~Ntv~aa~r~~G 303 (303)
T 4b4u_A 279 PGGVGPMTITTLIRQTVEAAEKALG 303 (303)
T ss_dssp SSSHHHHHHHHHHHHHHHHHHHHHC
T ss_pred CCCchHHHHHHHHHHHHHHHHHhcC
Confidence 9999999999999999999999876
|
| >4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} | Back alignment and structure |
|---|
| >4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} | Back alignment and structure |
|---|
| >1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* | Back alignment and structure |
|---|
| >1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 | Back alignment and structure |
|---|
| >3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A | Back alignment and structure |
|---|
| >2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A | Back alignment and structure |
|---|
| >1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* | Back alignment and structure |
|---|
| >3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* | Back alignment and structure |
|---|
| >1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A | Back alignment and structure |
|---|
| >1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* | Back alignment and structure |
|---|
| >3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* | Back alignment and structure |
|---|
| >2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* | Back alignment and structure |
|---|
| >3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* | Back alignment and structure |
|---|
| >2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A | Back alignment and structure |
|---|
| >2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* | Back alignment and structure |
|---|
| >3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* | Back alignment and structure |
|---|
| >1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 | Back alignment and structure |
|---|
| >3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* | Back alignment and structure |
|---|
| >2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* | Back alignment and structure |
|---|
| >1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* | Back alignment and structure |
|---|
| >2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* | Back alignment and structure |
|---|
| >1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A | Back alignment and structure |
|---|
| >1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 | Back alignment and structure |
|---|
| >2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} | Back alignment and structure |
|---|
| >3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* | Back alignment and structure |
|---|
| >3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* | Back alignment and structure |
|---|
| >3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* | Back alignment and structure |
|---|
| >4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A | Back alignment and structure |
|---|
| >3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 | Back alignment and structure |
|---|
| >1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* | Back alignment and structure |
|---|
| >2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* | Back alignment and structure |
|---|
| >2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} | Back alignment and structure |
|---|
| >3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} | Back alignment and structure |
|---|
| >1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* | Back alignment and structure |
|---|
| >4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} | Back alignment and structure |
|---|
| >3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A | Back alignment and structure |
|---|
| >3hdj_A Probable ornithine cyclodeaminase; APC62486, bordetella pertussis TOH structural genomics, PSI-2, protein structure initiative; 1.70A {Bordetella pertussis} | Back alignment and structure |
|---|
| >3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* | Back alignment and structure |
|---|
| >3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* | Back alignment and structure |
|---|
| >3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* | Back alignment and structure |
|---|
| >1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* | Back alignment and structure |
|---|
| >1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} | Back alignment and structure |
|---|
| >4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* | Back alignment and structure |
|---|
| >2i99_A MU-crystallin homolog; thyroid hormine binding protein, oxidoreductase; HET: NDP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >1omo_A Alanine dehydrogenase; two-domain, beta-sandwich-dimer, rossmann-fold NAD domain, human MU crystallin homolog; HET: NAD; 2.32A {Archaeoglobus fulgidus} SCOP: c.2.1.13 PDB: 1vll_A | Back alignment and structure |
|---|
| >2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B | Back alignment and structure |
|---|
| >2qrj_A Saccharopine dehydrogenase, NAD+, L-lysine- forming; sulfate, rossmann fold, alpha-aminoadipate pathway, fungal lysine biosynthesis; 1.60A {Saccharomyces cerevisiae} PDB: 2qrk_A* 2qrl_A* 2q99_A 3ugk_A 3uh1_A* 3uha_A* | Back alignment and structure |
|---|
| >2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A | Back alignment and structure |
|---|
| >1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 | Back alignment and structure |
|---|
| >2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1x7d_A Ornithine cyclodeaminase; binds NAD+, binds L-ornithine, binds L-proline, 2 bundle, beta barrel, rossmann fold, lyase; HET: NAD ORN MES; 1.60A {Pseudomonas putida} SCOP: c.2.1.13 PDB: 1u7h_A* | Back alignment and structure |
|---|
| >1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* | Back alignment and structure |
|---|
| >2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A | Back alignment and structure |
|---|
| >3nv9_A Malic enzyme; rossmann fold, oxidoreductase; 2.25A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* | Back alignment and structure |
|---|
| >1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* | Back alignment and structure |
|---|
| >3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* | Back alignment and structure |
|---|
| >3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A | Back alignment and structure |
|---|
| >2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* | Back alignment and structure |
|---|
| >3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} | Back alignment and structure |
|---|
| >4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} | Back alignment and structure |
|---|
| >3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} | Back alignment and structure |
|---|
| >3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} | Back alignment and structure |
|---|
| >1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A | Back alignment and structure |
|---|
| >3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} | Back alignment and structure |
|---|
| >3obb_A Probable 3-hydroxyisobutyrate dehydrogenase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics; HET: EPE; 2.20A {Pseudomonas aeruginosa} PDB: 3q3c_A* | Back alignment and structure |
|---|
| >3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} | Back alignment and structure |
|---|
| >1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 | Back alignment and structure |
|---|
| >4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} | Back alignment and structure |
|---|
| >1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 | Back alignment and structure |
|---|
| >4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* | Back alignment and structure |
|---|
| >2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* | Back alignment and structure |
|---|
| >2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* | Back alignment and structure |
|---|
| >2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* | Back alignment and structure |
|---|
| >3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} | Back alignment and structure |
|---|
| >1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A | Back alignment and structure |
|---|
| >3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* | Back alignment and structure |
|---|
| >1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* | Back alignment and structure |
|---|
| >2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* | Back alignment and structure |
|---|
| >1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* | Back alignment and structure |
|---|
| >4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* | Back alignment and structure |
|---|
| >3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* | Back alignment and structure |
|---|
| >2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* | Back alignment and structure |
|---|
| >2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 | Back alignment and structure |
|---|
| >4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* | Back alignment and structure |
|---|
| >3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* | Back alignment and structure |
|---|
| >3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* | Back alignment and structure |
|---|
| >3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... | Back alignment and structure |
|---|
| >2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* | Back alignment and structure |
|---|
| >3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* | Back alignment and structure |
|---|
| >3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* | Back alignment and structure |
|---|
| >2izz_A Pyrroline-5-carboxylate reductase 1; amino-acid biosynthesis, NADP, oxidoreductase, proline biosy; HET: NAD; 1.95A {Homo sapiens} PDB: 2ger_A 2gr9_A* 2gra_A* | Back alignment and structure |
|---|
| >3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} | Back alignment and structure |
|---|
| >4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* | Back alignment and structure |
|---|
| >2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* | Back alignment and structure |
|---|
| >4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A | Back alignment and structure |
|---|
| >3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A | Back alignment and structure |
|---|
| >3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} | Back alignment and structure |
|---|
| >3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1gq2_A Malic enzyme; oxidoreductase, pigeon liver, NADP-dependent, NAD-NADP selectivity, decarboxylase, malate, Mn2+; HET: NAP; 2.5A {Columba livia} SCOP: c.2.1.7 c.58.1.3 PDB: 2aw5_A | Back alignment and structure |
|---|
| >2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* | Back alignment and structure |
|---|
| >3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* | Back alignment and structure |
|---|
| >1o0s_A NAD-ME, NAD-dependent malic enzyme; oxidoreductase, oxidative decarboxylase, rossmann fold, MAla dehydrogenase; HET: NAI; 2.00A {Ascaris suum} SCOP: c.2.1.7 c.58.1.3 PDB: 1llq_A* | Back alignment and structure |
|---|
| >3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* | Back alignment and structure |
|---|
| >1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* | Back alignment and structure |
|---|
| >2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* | Back alignment and structure |
|---|
| >2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A | Back alignment and structure |
|---|
| >4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} | Back alignment and structure |
|---|
| >1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* | Back alignment and structure |
|---|
| >3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} | Back alignment and structure |
|---|
| >1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A | Back alignment and structure |
|---|
| >3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 | Back alignment and structure |
|---|
| >4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} | Back alignment and structure |
|---|
| >3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* | Back alignment and structure |
|---|
| >1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* | Back alignment and structure |
|---|
| >3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D | Back alignment and structure |
|---|
| >3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* | Back alignment and structure |
|---|
| >3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} | Back alignment and structure |
|---|
| >3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} | Back alignment and structure |
|---|
| >3ojo_A CAP5O; rossmann fold, complex with cofactor NAD and EU(PDC)3, oxidi conformation, oxidoreductase; HET: NAD PDC; 2.50A {Staphylococcus aureus} PDB: 3ojl_A* | Back alignment and structure |
|---|
| >3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4gwg_A 6-phosphogluconate dehydrogenase, decarboxylating; 6-phosphoglyconate dehydrogenase, NADP, oxido; HET: MES; 1.39A {Homo sapiens} PDB: 4gwk_A* 2jkv_A* 2pgd_A 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A | Back alignment and structure |
|---|
| >3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* | Back alignment and structure |
|---|
| >4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} | Back alignment and structure |
|---|
| >1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A | Back alignment and structure |
|---|
| >4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A | Back alignment and structure |
|---|
| >4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A | Back alignment and structure |
|---|
| >2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} | Back alignment and structure |
|---|
| >3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A | Back alignment and structure |
|---|
| >2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* | Back alignment and structure |
|---|
| >3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} | Back alignment and structure |
|---|
| >4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} | Back alignment and structure |
|---|
| >1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 | Back alignment and structure |
|---|
| >2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* | Back alignment and structure |
|---|
| >1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A | Back alignment and structure |
|---|
| >3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* | Back alignment and structure |
|---|
| >2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A | Back alignment and structure |
|---|
| >2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A | Back alignment and structure |
|---|
| >3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >2iz1_A 6-phosphogluconate dehydrogenase, decarboxylating; pentose shunt, oxidoreductase, gluconate utilization; HET: ATR RES P33; 2.30A {Lactococcus lactis} PDB: 2iz0_A* 2iyp_A* 2iyo_A* | Back alignment and structure |
|---|
| >4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* | Back alignment and structure |
|---|
| >3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1pjq_A CYSG, siroheme synthase; rossman fold, nucleotide binding motif, SAM, NAD, phosphoserine, transferase/oxidoreductase/lyase complex; HET: SEP PGE SAH; 2.21A {Salmonella typhimurium} SCOP: c.2.1.11 c.90.1.1 e.37.1.1 PDB: 1pjs_A* 1pjt_A* | Back alignment and structure |
|---|
| >3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A | Back alignment and structure |
|---|
| >3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* | Back alignment and structure |
|---|
| >4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} | Back alignment and structure |
|---|
| >3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} | Back alignment and structure |
|---|
| >3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} | Back alignment and structure |
|---|
| >1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A | Back alignment and structure |
|---|
| >1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* | Back alignment and structure |
|---|
| >1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 | Back alignment and structure |
|---|
| >3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 | Back alignment and structure |
|---|
| >4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A | Back alignment and structure |
|---|
| >3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} | Back alignment and structure |
|---|
| >2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} | Back alignment and structure |
|---|
| >2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} | Back alignment and structure |
|---|
| >1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} | Back alignment and structure |
|---|
| >2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* | Back alignment and structure |
|---|
| >4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A | Back alignment and structure |
|---|
| >1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* | Back alignment and structure |
|---|
| >1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* | Back alignment and structure |
|---|
| >4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1pj3_A NAD-dependent malic enzyme, mitochondrial; oxidative decarboxylase, oxidoreductase; HET: NAD; 2.10A {Homo sapiens} SCOP: c.2.1.7 c.58.1.3 PDB: 1pj2_A* 1do8_A* 1pj4_A* 1qr6_A* 1efl_A* 1pjl_A* 1efk_A* 1gz4_A* 1gz3_A* | Back alignment and structure |
|---|
| >3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} | Back alignment and structure |
|---|
| >1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E | Back alignment and structure |
|---|
| >4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} | Back alignment and structure |
|---|
| >3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A | Back alignment and structure |
|---|
| >1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* | Back alignment and structure |
|---|
| >3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* | Back alignment and structure |
|---|
| >2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* | Back alignment and structure |
|---|
| >4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} | Back alignment and structure |
|---|
| >1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} | Back alignment and structure |
|---|
| >3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} | Back alignment and structure |
|---|
| >4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* | Back alignment and structure |
|---|
| >1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 | Back alignment and structure |
|---|
| >3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* | Back alignment and structure |
|---|
| >1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 | Back alignment and structure |
|---|
| >3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A | Back alignment and structure |
|---|
| >2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} | Back alignment and structure |
|---|
| >3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A | Back alignment and structure |
|---|
| >2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} | Back alignment and structure |
|---|
| >3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* | Back alignment and structure |
|---|
| >3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} | Back alignment and structure |
|---|
| >1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} | Back alignment and structure |
|---|
| >2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A | Back alignment and structure |
|---|
| >1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A | Back alignment and structure |
|---|
| >2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* | Back alignment and structure |
|---|
| >3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1x0v_A GPD-C, GPDH-C, glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic; two independent domains, GXGXXG motif, oxidoreductase; 2.30A {Homo sapiens} PDB: 1x0x_A* 1wpq_A* 2pla_A* | Back alignment and structure |
|---|
| >3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* | Back alignment and structure |
|---|
| >3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* | Back alignment and structure |
|---|
| >1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} | Back alignment and structure |
|---|
| >4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* | Back alignment and structure |
|---|
| >4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* | Back alignment and structure |
|---|
| >3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} | Back alignment and structure |
|---|
| >3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} | Back alignment and structure |
|---|
| >3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* | Back alignment and structure |
|---|
| >4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* | Back alignment and structure |
|---|
| >3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} | Back alignment and structure |
|---|
| >3tri_A Pyrroline-5-carboxylate reductase; amino acid biosynthesis, oxidoreductase; HET: NAP; 2.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* | Back alignment and structure |
|---|
| >1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* | Back alignment and structure |
|---|
| >2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* | Back alignment and structure |
|---|
| >3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} | Back alignment and structure |
|---|
| >2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} | Back alignment and structure |
|---|
| >3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* | Back alignment and structure |
|---|
| >3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A | Back alignment and structure |
|---|
| >3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3fr7_A Putative ketol-acid reductoisomerase (OS05G057370 protein); rossmann fold, NADPH, knotted protein, branched-chain amino biosynthesis; 1.55A {Oryza sativa japonica group} PDB: 3fr8_A* 1qmg_A* 1yve_I* | Back alignment and structure |
|---|
| >2pgd_A 6-phosphogluconate dehydrogenase; oxidoreductase (CHOH(D)-NADP+(A)); 2.00A {Ovis aries} SCOP: a.100.1.1 c.2.1.6 PDB: 1pgo_A* 1pgp_A* 1pgq_A* 1pgn_A 2jkv_A* | Back alignment and structure |
|---|
| >3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* | Back alignment and structure |
|---|
| >3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* | Back alignment and structure |
|---|
| >1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} | Back alignment and structure |
|---|
| >2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A | Back alignment and structure |
|---|
| >3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A | Back alignment and structure |
|---|
| >3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* | Back alignment and structure |
|---|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* | Back alignment and structure |
|---|
| >1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A | Back alignment and structure |
|---|
| >1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* | Back alignment and structure |
|---|
| >2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* | Back alignment and structure |
|---|
| >1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* | Back alignment and structure |
|---|
| >3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} | Back alignment and structure |
|---|
| >1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* | Back alignment and structure |
|---|
| >4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} | Back alignment and structure |
|---|
| >3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* | Back alignment and structure |
|---|
| >3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* | Back alignment and structure |
|---|
| >2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} | Back alignment and structure |
|---|
| >1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... | Back alignment and structure |
|---|
| >4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} | Back alignment and structure |
|---|
| >2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* | Back alignment and structure |
|---|
| >3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* | Back alignment and structure |
|---|
| >4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A | Back alignment and structure |
|---|
| >1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 | Back alignment and structure |
|---|
| >2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A | Back alignment and structure |
|---|
| >3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* | Back alignment and structure |
|---|
| >3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* | Back alignment and structure |
|---|
| >3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* | Back alignment and structure |
|---|
| >1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* | Back alignment and structure |
|---|
| >3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} | Back alignment and structure |
|---|
| >3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} | Back alignment and structure |
|---|
| >3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* | Back alignment and structure |
|---|
| >3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} | Back alignment and structure |
|---|
| >2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1pgj_A 6PGDH, 6-PGDH, 6-phosphogluconate dehydrogenase; oxidoreductase, CHOH(D)-NADP+(B); 2.82A {Trypanosoma brucei} SCOP: a.100.1.1 c.2.1.6 | Back alignment and structure |
|---|
| >1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A | Back alignment and structure |
|---|
| >1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* | Back alignment and structure |
|---|
| >3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* | Back alignment and structure |
|---|
| >2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* | Back alignment and structure |
|---|
| >4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* | Back alignment and structure |
|---|
| >2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* | Back alignment and structure |
|---|
| >3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* | Back alignment and structure |
|---|
| >2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* | Back alignment and structure |
|---|
| >1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* | Back alignment and structure |
|---|
| >2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* | Back alignment and structure |
|---|
| >2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D | Back alignment and structure |
|---|
| >2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
| >2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A | Back alignment and structure |
|---|
| >3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} | Back alignment and structure |
|---|
| >3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* | Back alignment and structure |
|---|
| >3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* | Back alignment and structure |
|---|
| >3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* | Back alignment and structure |
|---|
| >2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} | Back alignment and structure |
|---|
| >3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* | Back alignment and structure |
|---|
| >4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* | Back alignment and structure |
|---|
| >1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A | Back alignment and structure |
|---|
| >4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* | Back alignment and structure |
|---|
| >3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A | Back alignment and structure |
|---|
| >2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} | Back alignment and structure |
|---|
| >1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* | Back alignment and structure |
|---|
| >3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* | Back alignment and structure |
|---|
| >4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* | Back alignment and structure |
|---|
| >3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 | Back alignment and structure |
|---|
| >3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} | Back alignment and structure |
|---|
| >4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* | Back alignment and structure |
|---|
| >2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* | Back alignment and structure |
|---|
| >1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* | Back alignment and structure |
|---|
| >1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A | Back alignment and structure |
|---|
| >3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* | Back alignment and structure |
|---|
| >3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} | Back alignment and structure |
|---|
| >4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* | Back alignment and structure |
|---|
| >1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* | Back alignment and structure |
|---|
| >2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A | Back alignment and structure |
|---|
| >1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* | Back alignment and structure |
|---|
| >2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 | Back alignment and structure |
|---|
| >3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 | Back alignment and structure |
|---|
| >2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 269 | ||||
| d1a4ia1 | 170 | c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy | 8e-54 | |
| d1b0aa1 | 166 | c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy | 1e-49 | |
| d1edza2 | 146 | c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/ | 1e-36 | |
| d1edza1 | 171 | c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy | 3e-36 | |
| d1a4ia2 | 125 | c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/ | 2e-24 | |
| d1b0aa2 | 121 | c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/ | 4e-24 |
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Aminoacid dehydrogenase-like, C-terminal domain domain: Methylenetetrahydrofolate dehydrogenase/cyclohydrolase species: Human (Homo sapiens) [TaxId: 9606]
Score = 170 bits (431), Expect = 8e-54
Identities = 82/167 (49%), Positives = 113/167 (67%)
Query: 98 FHPLNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQ 157
+N G LA FIPCTPKGC+EL+ +GV I G++AVV+GRS IVG P LL
Sbjct: 1 LTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLL 60
Query: 158 RHHATVSIVHALTKNPEQITSEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSC 217
++ATV+ H+ T + ++ ++ DI++ A G +V+G W+KPGA+V+D G V D
Sbjct: 61 WNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKK 120
Query: 218 EYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSNTLDSAKR 264
G +++GDV Y+EA AS ITPVPGGVGPMTVAML+ +T++SAKR
Sbjct: 121 PNGRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKR 167
|
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 | Back information, alignment and structure |
|---|
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 269 | |||
| d1b0aa1 | 166 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1a4ia1 | 170 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1edza1 | 171 | Methylenetetrahydrofolate dehydrogenase/cyclohydro | 100.0 | |
| d1edza2 | 146 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak | 99.97 | |
| d1b0aa2 | 121 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc | 99.94 | |
| d1a4ia2 | 125 | Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum | 99.94 | |
| d1nyta1 | 170 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 99.86 | |
| d1vi2a1 | 182 | Putative shikimate dehydrogenase YdiB {Escherichia | 99.84 | |
| d1npya1 | 167 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 99.83 | |
| d1nvta1 | 177 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 99.82 | |
| d1p77a1 | 171 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 99.8 | |
| d1gpja2 | 159 | Glutamyl tRNA-reductase middle domain {Archaeon Me | 99.4 | |
| d1vi2a2 | 102 | Putative shikimate dehydrogenase YdiB {Escherichia | 99.09 | |
| d1v8ba1 | 163 | S-adenosylhomocystein hydrolase {Plasmodium falcip | 99.06 | |
| d1li4a1 | 163 | S-adenosylhomocystein hydrolase {Human (Homo sapie | 99.03 | |
| d1p77a2 | 101 | Shikimate 5-dehydrogenase AroE {Haemophilus influe | 98.97 | |
| d1nvta2 | 110 | Shikimate 5-dehydrogenase AroE {Archaeon Methanoco | 98.96 | |
| d1nyta2 | 101 | Shikimate 5-dehydrogenase AroE {Escherichia coli [ | 98.95 | |
| d1npya2 | 102 | Shikimate 5-dehydrogenase-like protein HI0607 {Hae | 98.91 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 98.84 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 98.78 | |
| d1l7da1 | 183 | Nicotinamide nucleotide transhydrogenase dI compon | 98.54 | |
| d1qp8a1 | 181 | Putative formate dehydrogenase {Archaeon Pyrobacul | 98.31 | |
| d1e5qa1 | 182 | Saccharopine reductase {Rice blast fungus (Magnapo | 98.21 | |
| d1j4aa1 | 197 | D-lactate dehydrogenase {Lactobacillus helveticus | 98.17 | |
| d1mx3a1 | 193 | Transcription corepressor CtbP {Human (Homo sapien | 98.11 | |
| d2jfga1 | 93 | UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase | 98.07 | |
| d1dxya1 | 199 | D-2-hydroxyisocaproate dehydrogenase {Lactobacillu | 98.01 | |
| d1ygya1 | 184 | Phosphoglycerate dehydrogenase {Mycobacterium tube | 98.0 | |
| d2naca1 | 188 | Formate dehydrogenase {Pseudomonas sp., strain 101 | 98.0 | |
| d1sc6a1 | 188 | Phosphoglycerate dehydrogenase {Escherichia coli [ | 97.94 | |
| d1gdha1 | 191 | D-glycerate dehydrogenase {Hyphomicrobium methylov | 97.89 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 97.87 | |
| d2pv7a2 | 152 | Prephenate dehydrogenase TyrA {Haemophilus influen | 97.79 | |
| d1vpda2 | 161 | Hydroxyisobutyrate dehydrogenase {Salmonella typhi | 97.77 | |
| d3cuma2 | 162 | Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru | 97.67 | |
| d1pjqa1 | 113 | Siroheme synthase CysG, domain 1 {Salmonella typhi | 97.65 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 97.61 | |
| d1hdoa_ | 205 | Biliverdin IX beta reductase {Human (Homo sapiens) | 97.57 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 97.55 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 97.36 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 97.27 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 97.24 | |
| d1cyda_ | 242 | Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 | 97.23 | |
| d1vl8a_ | 251 | Gluconate 5-dehydrogenase {Thermotoga maritima [Ta | 97.23 | |
| d1n1ea2 | 189 | Glycerol-3- phosphate dehydrogenase {Trypanosome ( | 97.21 | |
| d1o5ia_ | 234 | beta-keto acyl carrier protein reductase {Thermoto | 97.2 | |
| d1pr9a_ | 244 | Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 | 97.2 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 97.15 | |
| d2ahra2 | 152 | Pyrroline-5-carboxylate reductase ProC {Streptococ | 97.14 | |
| d1uzma1 | 237 | beta-keto acyl carrier protein reductase {Mycobact | 97.14 | |
| d1omoa_ | 320 | Archaeal alanine dehydrogenase {Archaeon Archaeogl | 97.14 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 97.13 | |
| d1kyqa1 | 150 | Bifunctional dehydrogenase/ferrochelatase Met8p, N | 97.08 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 97.08 | |
| d2o23a1 | 248 | Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho | 97.08 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 97.05 | |
| d1c1da1 | 201 | Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ | 97.04 | |
| d1i36a2 | 152 | Conserved hypothetical protein MTH1747 {Archaeon M | 97.03 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 97.02 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 97.01 | |
| d1q7ba_ | 243 | beta-keto acyl carrier protein reductase {Escheric | 97.0 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 97.0 | |
| d1h5qa_ | 260 | Mannitol dehydrogenase {Mushroom (Agaricus bisporu | 97.0 | |
| d2bkaa1 | 232 | TAT-interacting protein TIP30 {Human (Homo sapiens | 96.99 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 96.99 | |
| d2ae2a_ | 259 | Tropinone reductase {Jimsonweed (Datura stramonium | 96.96 | |
| d1hdca_ | 254 | 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre | 96.93 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 96.92 | |
| d2pgda2 | 176 | 6-phosphogluconate dehydrogenase {Sheep (Ovis orie | 96.92 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 96.9 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 96.88 | |
| d2hmva1 | 134 | Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | 96.87 | |
| d2d1ya1 | 248 | Hypothetical protein TTHA0369 {Thermus thermophilu | 96.87 | |
| d1w6ua_ | 294 | 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H | 96.86 | |
| d1ulsa_ | 242 | beta-keto acyl carrier protein reductase {Thermus | 96.86 | |
| d1geea_ | 261 | Glucose dehydrogenase {Bacillus megaterium [TaxId: | 96.86 | |
| d2hjsa1 | 144 | Usg-1 protein homolog PA3116 {Pseudomonas aerugino | 96.85 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 96.85 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 96.85 | |
| d1ks9a2 | 167 | Ketopantoate reductase PanE {Escherichia coli [Tax | 96.82 | |
| d1txga2 | 180 | Glycerol-3- phosphate dehydrogenase {Archaeoglobus | 96.81 | |
| d1ydea1 | 250 | Retinal dehydrogenase/reductase 3 {Human (Homo sap | 96.81 | |
| d1xq1a_ | 259 | Tropinone reductase {Thale cress (Arabidopsis thal | 96.81 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 96.79 | |
| d2ag5a1 | 245 | Dehydrogenase/reductase SDR family member 6, DHRS6 | 96.79 | |
| d1nffa_ | 244 | Putative oxidoreductase Rv2002 {Mycobacterium tube | 96.79 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 96.78 | |
| d1fmca_ | 255 | 7-alpha-hydroxysteroid dehydrogenase {Escherichia | 96.77 | |
| d2c07a1 | 251 | beta-keto acyl carrier protein reductase {Malaria | 96.75 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 96.75 | |
| d1k2wa_ | 256 | Sorbitol dehydrogenase {Rhodobacter sphaeroides [T | 96.75 | |
| d2a4ka1 | 241 | beta-keto acyl carrier protein reductase {Thermus | 96.73 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 96.73 | |
| d1ulua_ | 256 | Enoyl-ACP reductase {Thermus thermophilus [TaxId: | 96.72 | |
| d2ew8a1 | 247 | (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb | 96.72 | |
| d1x1ta1 | 260 | D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas | 96.72 | |
| d1leha1 | 230 | Leucine dehydrogenase {Bacillus sphaericus [TaxId: | 96.71 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 96.71 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 96.7 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 96.7 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 96.7 | |
| d1d7oa_ | 297 | Enoyl-ACP reductase {Oil seed rape (Brassica napus | 96.69 | |
| d1ps9a3 | 179 | 2,4-dienoyl-CoA reductase, middle domain {Escheric | 96.69 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 96.69 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 96.68 | |
| d1x7da_ | 340 | Ornithine cyclodeaminase {Pseudomonas putida [TaxI | 96.68 | |
| d1pj3a1 | 294 | Mitochondrial NAD(P)-dependent malic enzyme {Human | 96.67 | |
| d2i76a2 | 153 | Hypothetical protein TM1727 {Thermotoga maritima [ | 96.66 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.65 | |
| d1mv8a2 | 202 | GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos | 96.64 | |
| d1hxha_ | 253 | 3beta/17beta hydroxysteroid dehydrogenase {Comamon | 96.64 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 96.64 | |
| d1seza1 | 373 | Protoporphyrinogen oxidase {Tobacco (Nicotiana tab | 96.63 | |
| d1zk4a1 | 251 | R-specific alcohol dehydrogenase {Lactobacillus br | 96.61 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.6 | |
| d1xu9a_ | 269 | 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom | 96.59 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 96.57 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 96.55 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 96.52 | |
| d1bdba_ | 276 | Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps | 96.51 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 96.5 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 96.5 | |
| d2pd4a1 | 274 | Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 | 96.5 | |
| d1sbya1 | 254 | Drosophila alcohol dehydrogenase {Fly (Drosophila | 96.47 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 96.45 | |
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 96.45 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 96.45 | |
| d1nhpa2 | 123 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 96.43 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 96.43 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 96.42 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 96.38 | |
| d1vl6a1 | 222 | Malate oxidoreductase (malic enzyme) {Thermotoga m | 96.38 | |
| d2bgka1 | 268 | Rhizome secoisolariciresinol dehydrogenase {Mayapp | 96.37 | |
| d1y1pa1 | 342 | Aldehyde reductase II {Sporobolomyces salmonicolor | 96.37 | |
| d2gz1a1 | 154 | Aspartate beta-semialdehyde dehydrogenase {Strepto | 96.35 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 96.34 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 96.33 | |
| d2h7ma1 | 268 | Enoyl-ACP reductase {Mycobacterium tuberculosis, T | 96.32 | |
| d1gz6a_ | 302 | (3R)-hydroxyacyl-CoA dehydrogenase domain of estra | 96.31 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 96.3 | |
| d1yqga2 | 152 | Pyrroline-5-carboxylate reductase ProC {Neisseria | 96.28 | |
| d1rkxa_ | 356 | CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc | 96.27 | |
| d1o8ca2 | 77 | Hypothetical protein YhdH {Escherichia coli [TaxId | 96.24 | |
| d1yxma1 | 297 | Peroxisomal trans 2-enoyl CoA reductase {Human (Ho | 96.23 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 96.23 | |
| d1spxa_ | 264 | Glucose dehydrogenase (5l265) {Nematode (Caenorhab | 96.23 | |
| d1gtea4 | 196 | Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su | 96.2 | |
| d1vl0a_ | 281 | DTDP-4-dehydrorhamnose reductase RfbD {Clostridium | 96.17 | |
| d2b69a1 | 312 | UDP-glucuronate decarboxylase 1 {Human (Homo sapie | 96.14 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 96.14 | |
| d1o0sa1 | 308 | Mitochondrial NAD(P)-dependent malic enzyme {Pig r | 96.13 | |
| d1t4ba1 | 146 | Aspartate beta-semialdehyde dehydrogenase {Escheri | 96.12 | |
| d1wdka3 | 186 | Fatty oxidation complex alpha subunit, middle doma | 96.11 | |
| d2c5aa1 | 363 | GDP-mannose-3', 5'-epimerase {Thale cress (Arabido | 96.1 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 96.1 | |
| d1qsga_ | 258 | Enoyl-ACP reductase {Escherichia coli [TaxId: 562] | 96.02 | |
| d1pvva2 | 163 | Ornithine transcarbamoylase {Archaeon Pyrococcus f | 96.01 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 96.0 | |
| d1gq2a1 | 298 | Mitochondrial NAD(P)-dependent malic enzyme {Domes | 95.94 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 95.94 | |
| d1c0pa1 | 268 | D-aminoacid oxidase, N-terminal domain {Rhodotorul | 95.9 | |
| d1mb4a1 | 147 | Aspartate beta-semialdehyde dehydrogenase {Vibrio | 95.9 | |
| d1qyda_ | 312 | Pinoresinol-lariciresinol reductase {Giant arborvi | 95.89 | |
| d1dhra_ | 236 | Dihydropteridin reductase (pteridine reductase) {R | 95.84 | |
| d2rhca1 | 257 | beta-keto acyl carrier protein reductase {Streptom | 95.83 | |
| d1jaya_ | 212 | Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae | 95.82 | |
| d2iida1 | 370 | L-aminoacid oxidase {Malayan pit viper (Calloselas | 95.76 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 95.75 | |
| d1lvla2 | 115 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 95.75 | |
| d2q46a1 | 252 | Hypothetical protein At5g02240 (T7H20_290) {Thale | 95.72 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 95.7 | |
| d1uaya_ | 241 | Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t | 95.69 | |
| d1p3da1 | 96 | UDP-N-acetylmuramate-alanine ligase MurC {Haemophi | 95.68 | |
| d1mv8a3 | 136 | GDP-mannose 6-dehydrogenase, GDP-binding domain {P | 95.63 | |
| d2a35a1 | 212 | Hypothetical protein PA4017 {Pseudomonas aeruginos | 95.61 | |
| d1tuga1 | 310 | Aspartate carbamoyltransferase catalytic subunit { | 95.61 | |
| d1j6ua1 | 89 | UDP-N-acetylmuramate-alanine ligase MurC {Thermoto | 95.57 | |
| d1v9la1 | 242 | Glutamate dehydrogenase {Pyrobaculum islandicum [T | 95.5 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 95.49 | |
| d1qyca_ | 307 | Phenylcoumaran benzylic ether reductase {Loblolly | 95.44 | |
| d2dw4a2 | 449 | Lysine-specific histone demethylase 1, LSD1 {Human | 95.42 | |
| d1gega_ | 255 | meso-2,3-butanediol dehydrogenase {Klebsiella pneu | 95.39 | |
| d1vkna1 | 176 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 95.38 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 95.37 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 95.35 | |
| d1u7za_ | 223 | Coenzyme A biosynthesis bifunctional protein CoaBC | 95.34 | |
| d2bi7a1 | 314 | UDP-galactopyranose mutase, N-terminal domain {Kle | 95.34 | |
| d1d7ya2 | 121 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 95.32 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 95.32 | |
| d1ebda2 | 117 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 95.3 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 95.21 | |
| d1fcda1 | 186 | Flavocytochrome c sulfide dehydrogenase, FCSD, fla | 95.16 | |
| d1onfa2 | 117 | Glutathione reductase {Plasmodium falciparum [TaxI | 95.12 | |
| d1bgva1 | 255 | Glutamate dehydrogenase {Clostridium symbiosum [Ta | 95.11 | |
| d1mo9a2 | 121 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 95.11 | |
| d1np3a2 | 182 | Class I ketol-acid reductoisomerase (KARI) {Pseudo | 95.04 | |
| d1gesa2 | 116 | Glutathione reductase {Escherichia coli [TaxId: 56 | 95.04 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 94.96 | |
| d1fjha_ | 257 | 3-alpha-hydroxysteroid dehydrogenase {Comamonas te | 94.92 | |
| d2cvza2 | 156 | Hydroxyisobutyrate dehydrogenase {Thermus thermoph | 94.91 | |
| d2g17a1 | 179 | N-acetyl-gamma-glutamyl-phosphate reductase ArgC { | 94.86 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 94.83 | |
| d1xgka_ | 350 | Negative transcriptional regulator NmrA {Aspergill | 94.8 | |
| d1xhca2 | 122 | NADH oxidase /nitrite reductase {Pyrococcus furios | 94.79 | |
| d3grsa2 | 125 | Glutathione reductase {Human (Homo sapiens) [TaxId | 94.76 | |
| d1gtma1 | 239 | Glutamate dehydrogenase {Archaeon Pyrococcus furio | 94.76 | |
| d1q1ra2 | 133 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 94.75 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 94.71 | |
| d1vlva2 | 161 | Ornithine transcarbamoylase {Thermotoga maritima [ | 94.7 | |
| d1rpna_ | 321 | GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos | 94.69 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 94.69 | |
| d1v59a2 | 122 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 94.67 | |
| d1udca_ | 338 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 94.65 | |
| d1djqa3 | 233 | Trimethylamine dehydrogenase, middle domain {Methy | 94.59 | |
| d1yovb1 | 426 | UBA3 {Human (Homo sapiens) [TaxId: 9606]} | 94.59 | |
| d2voua1 | 265 | Dihydroxypyridine hydroxylase DhpH {Arthrobacter n | 94.58 | |
| d2gv8a2 | 107 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 94.57 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 94.55 | |
| d2bcgg1 | 297 | Guanine nucleotide dissociation inhibitor, GDI {Ba | 94.54 | |
| d1hwxa1 | 293 | Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: | 94.5 | |
| d1b26a1 | 234 | Glutamate dehydrogenase {Thermotoga maritima [TaxI | 94.49 | |
| d1b5qa1 | 347 | Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | 94.47 | |
| d1ooea_ | 235 | Dihydropteridin reductase (pteridine reductase) {N | 94.4 | |
| d1oaaa_ | 259 | Sepiapterin reductase {Mouse (Mus musculus) [TaxId | 94.38 | |
| d3lada2 | 119 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 94.36 | |
| d2ivda1 | 347 | Protoporphyrinogen oxidase {Myxococcus xanthus [Ta | 94.35 | |
| d1lqta1 | 216 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 94.32 | |
| d1pgja2 | 178 | 6-phosphogluconate dehydrogenase {Trypanosoma bruc | 94.31 | |
| d1n7ha_ | 339 | GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop | 94.27 | |
| d1i24a_ | 393 | Sulfolipid biosynthesis protein SQD1 {Thale cress | 94.25 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 94.13 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 94.09 | |
| d1dxla2 | 123 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 94.04 | |
| d1d5ta1 | 336 | Guanine nucleotide dissociation inhibitor, GDI {Co | 93.98 | |
| d1w4xa2 | 235 | Phenylacetone monooxygenase {Thermobifida fusca [T | 93.88 | |
| d1trba2 | 126 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 93.84 | |
| d1n2sa_ | 298 | dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S | 93.68 | |
| d1cjca1 | 225 | Adrenodoxin reductase of mitochondrial p450 system | 93.64 | |
| d1ml4a2 | 157 | Aspartate carbamoyltransferase catalytic subunit { | 93.63 | |
| d1jw9b_ | 247 | Molybdenum cofactor biosynthesis protein MoeB {Esc | 93.62 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 93.61 | |
| d2cvoa1 | 183 | Putative semialdehyde dehydrogenase {Rice (Oryza s | 93.58 | |
| d1dxha2 | 185 | Ornithine transcarbamoylase {Pseudomonas aeruginos | 93.58 | |
| d1otha2 | 170 | Ornithine transcarbamoylase {Human (Homo sapiens) | 93.56 | |
| d1trba1 | 190 | Thioredoxin reductase {Escherichia coli [TaxId: 56 | 93.56 | |
| d1ojta2 | 125 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 93.48 | |
| d1h6va2 | 122 | Mammalian thioredoxin reductase {Rat (Rattus norve | 93.46 | |
| d1ryia1 | 276 | Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | 93.43 | |
| d2gv8a1 | 335 | Flavin-dependent monoxygenase SPBP16F5.08c {Schizo | 93.39 | |
| d1gtea3 | 153 | Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su | 93.37 | |
| d1lqta2 | 239 | Ferredoxin:NADP reductase FprA {Mycobacterium tube | 93.26 | |
| d1t2aa_ | 347 | GDP-mannose 4,6-dehydratase {Human (Homo sapiens) | 93.24 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 93.2 | |
| d1cjca2 | 230 | Adrenodoxin reductase of mitochondrial p450 system | 93.19 | |
| d1ek6a_ | 346 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 93.18 | |
| d2v5za1 | 383 | Monoamine oxidase B {Human (Homo sapiens) [TaxId: | 92.98 | |
| d1dlja2 | 196 | UDP-glucose dehydrogenase (UDPGDH) {Streptococcus | 92.94 | |
| d1e7wa_ | 284 | Dihydropteridin reductase (pteridine reductase) {L | 92.9 | |
| d1sb8a_ | 341 | UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo | 92.87 | |
| d1pg5a2 | 153 | Aspartate carbamoyltransferase catalytic subunit { | 92.8 | |
| d1db3a_ | 357 | GDP-mannose 4,6-dehydratase {Escherichia coli [Tax | 92.8 | |
| d2at2a2 | 151 | Aspartate carbamoyltransferase catalytic subunit { | 92.61 | |
| d1orra_ | 338 | CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: | 92.55 | |
| d2blla1 | 342 | Polymyxin resistance protein ArnA (PrmI) {Escheric | 92.49 | |
| d3c96a1 | 288 | Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: | 92.44 | |
| d1e6ua_ | 315 | GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( | 92.41 | |
| d1f06a1 | 170 | Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb | 92.38 | |
| d1vdca2 | 130 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 92.35 | |
| d1yo6a1 | 250 | Putative carbonyl reductase sniffer {Caenorhabditi | 92.32 | |
| d1q1ra1 | 185 | Putidaredoxin reductase {Pseudomonas putida [TaxId | 92.3 | |
| d1z45a2 | 347 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 92.23 | |
| d1fl2a2 | 126 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 92.2 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 92.17 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 92.17 | |
| d1edoa_ | 244 | beta-keto acyl carrier protein reductase {Oil seed | 92.11 | |
| d2bd0a1 | 240 | Bacterial sepiapterin reductase {Chlorobium tepidu | 92.11 | |
| d1i8ta1 | 298 | UDP-galactopyranose mutase, N-terminal domain {Esc | 92.06 | |
| d1b7go1 | 178 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 91.75 | |
| d1duvg2 | 183 | Ornithine transcarbamoylase {Escherichia coli [Tax | 91.73 | |
| d1pj5a2 | 305 | N,N-dimethylglycine oxidase {Arthrobacter globifor | 91.68 | |
| d2h1qa1 | 251 | Hypothetical protein Dhaf_3308 {Desulfitobacterium | 91.63 | |
| d2gqfa1 | 253 | Hypothetical protein HI0933 {Haemophilus influenza | 91.47 | |
| d2gf3a1 | 281 | Sarcosine oxidase {Bacillus sp., strain b0618 [Tax | 91.34 | |
| d1id1a_ | 153 | Rck domain from putative potassium channel Kch {Es | 91.29 | |
| d1vdca1 | 192 | Thioredoxin reductase {Mouse-ear cress (Arabidopsi | 91.13 | |
| d2i0za1 | 251 | Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] | 91.06 | |
| d1mxha_ | 266 | Dihydropteridin reductase (pteridine reductase) {T | 90.92 | |
| d1snya_ | 248 | Carbonyl reductase sniffer {Fruit fly (Drosophila | 90.89 | |
| d1zmta1 | 252 | Halohydrin dehalogenase HheC {Agrobacterium tumefa | 90.88 | |
| d1d4ca2 | 322 | Flavocytochrome c3 (respiratory fumarate reductase | 90.87 | |
| d1oc2a_ | 346 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 90.75 | |
| d1k0ia1 | 292 | p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a | 90.75 | |
| d1vm6a3 | 128 | Dihydrodipicolinate reductase {Thermotoga maritima | 90.43 | |
| d1djqa2 | 156 | Trimethylamine dehydrogenase, C-terminal domain {M | 90.11 | |
| d1rp0a1 | 278 | Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara | 90.02 | |
| d1y0pa2 | 308 | Flavocytochrome c3 (respiratory fumarate reductase | 89.95 | |
| d1y81a1 | 116 | Hypothetical protein PF0725 {Pyrococcus furiosus [ | 89.87 | |
| d1w4xa1 | 298 | Phenylacetone monooxygenase {Thermobifida fusca [T | 89.82 | |
| d2fr1a1 | 259 | Erythromycin synthase, eryAI, 1st ketoreductase mo | 89.7 | |
| d1qmga2 | 226 | Class II ketol-acid reductoisomerase (KARI) {Spina | 89.69 | |
| d1dlja3 | 108 | UDP-glucose dehydrogenase (UDPGDH), C-terminal (UD | 89.69 | |
| d2csua1 | 129 | Acetate-CoA ligase alpha chain, AcdA, N-terminal d | 89.58 | |
| d1fl2a1 | 184 | Alkyl hydroperoxide reductase subunit F (AhpF), C- | 89.46 | |
| d1uh5a_ | 329 | Enoyl-ACP reductase {Malaria parasite (Plasmodium | 89.24 | |
| d2czca2 | 172 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 89.07 | |
| d1v59a1 | 233 | Dihydrolipoamide dehydrogenase {Baker's yeast (Sac | 88.88 | |
| d2d59a1 | 139 | Hypothetical protein PH1109 {Pyrococcus horikoshii | 88.75 | |
| d1m6ia2 | 137 | Apoptosis-inducing factor (AIF) {Human (Homo sapie | 88.63 | |
| d1gesa1 | 217 | Glutathione reductase {Escherichia coli [TaxId: 56 | 88.53 | |
| d1aoga2 | 117 | Trypanothione reductase {Trypanosoma cruzi [TaxId: | 88.27 | |
| d1cf2o1 | 171 | Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { | 88.21 | |
| d2bs2a2 | 336 | Fumarate reductase {Wolinella succinogenes [TaxId: | 88.18 | |
| d1ekxa2 | 160 | Aspartate carbamoyltransferase catalytic subunit { | 87.95 | |
| d1feca2 | 117 | Trypanothione reductase {Crithidia fasciculata [Ta | 87.95 | |
| d1nvmb1 | 157 | Acetaldehyde dehydrogenase (acylating) {Pseudomona | 87.91 | |
| d1dxla1 | 221 | Dihydrolipoamide dehydrogenase {Garden pea (Pisum | 87.75 | |
| d1jtva_ | 285 | Human estrogenic 17beta-hydroxysteroid dehydrogena | 87.59 | |
| d1qo8a2 | 317 | Flavocytochrome c3 (respiratory fumarate reductase | 87.56 | |
| d1ebda1 | 223 | Dihydrolipoamide dehydrogenase {Bacillus stearothe | 87.23 | |
| d1ojta1 | 229 | Dihydrolipoamide dehydrogenase {Neisseria meningit | 87.22 | |
| d1lvla1 | 220 | Dihydrolipoamide dehydrogenase {Pseudomonas putida | 86.64 | |
| d1kjqa2 | 111 | Glycinamide ribonucleotide transformylase PurT, N- | 86.49 | |
| d1xhca1 | 167 | NADH oxidase /nitrite reductase {Pyrococcus furios | 86.2 | |
| d3etja2 | 78 | N5-carboxyaminoimidazole ribonucleotide synthetase | 86.11 | |
| d1kifa1 | 246 | D-aminoacid oxidase, N-terminal domain {Pig (Sus s | 86.05 | |
| d1kewa_ | 361 | dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus | 85.97 | |
| d1h6va1 | 235 | Mammalian thioredoxin reductase {Rat (Rattus norve | 85.72 | |
| d1j5pa4 | 132 | Hypothetical protein TM1643 {Thermotoga maritima [ | 85.62 | |
| d2ax3a2 | 211 | Hypothetical protein TM0922, N-terminal domain {Th | 85.44 | |
| d1yl7a1 | 135 | Dihydrodipicolinate reductase {Mycobacterium tuber | 85.13 | |
| d1pn0a1 | 360 | Phenol hydroxylase {Soil-living yeast (Trichosporo | 85.09 | |
| d3lada1 | 229 | Dihydrolipoamide dehydrogenase {Azotobacter vinela | 84.85 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 84.58 | |
| d2gjca1 | 311 | Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( | 84.41 | |
| d1neka2 | 330 | Succinate dehydogenase {Escherichia coli [TaxId: 5 | 84.33 | |
| d3grsa1 | 221 | Glutathione reductase {Human (Homo sapiens) [TaxId | 84.31 | |
| d1n4wa1 | 367 | Cholesterol oxidase of GMC family {Streptomyces sp | 84.07 | |
| d2f5va1 | 379 | Pyranose 2-oxidase {White-rot fungus (Peniophora s | 83.87 | |
| d1onfa1 | 259 | Glutathione reductase {Plasmodium falciparum [TaxI | 83.64 | |
| d1mo9a1 | 261 | NADH-dependent 2-ketopropyl coenzyme M oxidoreduct | 83.61 | |
| d2fy8a1 | 129 | Potassium channel-related protein MthK {Archaeon M | 83.6 | |
| d1eq2a_ | 307 | ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric | 83.43 | |
| d1nhpa1 | 198 | NADH peroxidase {Enterococcus faecalis [TaxId: 135 | 83.19 | |
| d1a9xa4 | 121 | Carbamoyl phosphate synthetase (CPS), large subuni | 82.75 | |
| d1ps9a2 | 162 | 2,4-dienoyl-CoA reductase, C-terminal domain {Esch | 82.16 | |
| d3coxa1 | 370 | Cholesterol oxidase of GMC family {Brevibacterium | 82.03 | |
| d2gmha1 | 380 | Electron transfer flavoprotein-ubiquinone oxidored | 81.52 | |
| d1gy8a_ | 383 | Uridine diphosphogalactose-4-epimerase (UDP-galact | 81.45 | |
| d1d7ya1 | 183 | NADH-dependent ferredoxin reductase, BphA4 {Pseudo | 81.17 | |
| d1vmea1 | 148 | ROO-like flavoprotein TM0755, C-terminal domain {T | 81.13 | |
| d1vkza2 | 90 | Glycinamide ribonucleotide synthetase (GAR-syn), N | 80.97 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 80.87 | |
| d1a9xa3 | 127 | Carbamoyl phosphate synthetase (CPS), large subuni | 80.83 |
| >d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: Aminoacid dehydrogenase-like, C-terminal domain domain: Methylenetetrahydrofolate dehydrogenase/cyclohydrolase species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=2.8e-51 Score=340.36 Aligned_cols=163 Identities=46% Similarity=0.781 Sum_probs=156.5
Q ss_pred cccceecccccCCCCCccccCCHHHHHHHHHHhCCCCccceEEEEcCCcccHHHHHHHHHhCCCEEEEEeCCCCCHhhhc
Q 024282 98 FHPLNIGNLAMRGREPLFIPCTPKGCIELLIRSGVEIMGKNAVVIGRSNIVGLPTSLLLQRHHATVSIVHALTKNPEQIT 177 (269)
Q Consensus 98 ~~~~n~g~l~~g~~~~~~~p~t~~g~~~~l~~~~~~l~gk~v~ViG~gg~vg~~~a~~L~~~ga~Vti~~~~t~~l~~~~ 177 (269)
||++|.|+|..+ .+.|+||||.|++++|++|+++++||+|+|||+|..||+|++.+|.++||+|++||++|+++.+.+
T Consensus 1 fhp~N~G~l~~~--~~~~~PcTp~aI~~lL~~y~i~l~GK~v~VIGrS~~VG~Pla~lL~~~gatVt~~h~~t~~l~~~~ 78 (166)
T d1b0aa1 1 FHPYNVGRLCQR--APRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHV 78 (166)
T ss_dssp CSHHHHHHHHTT--CCSSCCHHHHHHHHHHHHTTCCCTTCEEEEECCCTTTHHHHHHHHHTTTCEEEEECSSCSCHHHHH
T ss_pred CCchhHHHHhCC--CCCCCCchHHHHHHHHHHcCcccccceEEEEeccccccHHHHHHHHHhhccccccccccchhHHHH
Confidence 689999999976 678999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CCCCEEEeccCCCCcccCCCcCCCcEEEEeeecCCCCCCCCCCceeecccchHHHhhHcceecccCCcccHHHHHHHHHH
Q 024282 178 SEADIVIAAAGVANLVRGSWLKPGAVVLDVGTCPVDDPSCEYGYRLMGDVCYEEAMRLASVITPVPGGVGPMTVAMLLSN 257 (269)
Q Consensus 178 ~~aDiVIsAtg~p~~i~~~~~~~g~vViDv~~~~~~~~~~~~~~~l~GDvd~~~~~~~~~~~tpvpgGvGp~T~~mLl~n 257 (269)
++|||||+|+|+|++++++|+|+|++|||+|+++.++ ++++||+||+++.++++++|||||||||||++|||+|
T Consensus 79 ~~ADivI~a~G~p~~i~~~~vk~g~vvIDvGi~~~~~------~~~~Gdvd~~~v~~~a~~~TPvPGGVGP~Tva~L~~N 152 (166)
T d1b0aa1 79 ENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLEN------GKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIEN 152 (166)
T ss_dssp HHCSEEEECSCCTTCBCTTTSCTTCEEEECCCEECTT------SCEECSBCHHHHHHHCSEECCSSSSSHHHHHHHHHHH
T ss_pred hhhhHhhhhccCcccccccccCCCcEEEecCceecCC------CCEEeccccHhHHhheeEeCCCCCcccHHHHHHHHHH
Confidence 9999999999999999999999999999999998755 2899999999999999999999999999999999999
Q ss_pred HHHHHHHHhCC
Q 024282 258 TLDSAKRAYGF 268 (269)
Q Consensus 258 ~v~a~~~~~~~ 268 (269)
+++++++|.+.
T Consensus 153 ~v~a~~~~~~~ 163 (166)
T d1b0aa1 153 TLQACVEYHDP 163 (166)
T ss_dssp HHHHHHHTTSC
T ss_pred HHHHHHHHhCc
Confidence 99999999763
|
| >d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} | Back information, alignment and structure |
|---|
| >d1vi2a2 c.58.1.5 (A:5-106) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p77a2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1nvta2 c.58.1.5 (A:1-110) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nyta2 c.58.1.5 (A:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1npya2 c.58.1.5 (A:1-102) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} | Back information, alignment and structure |
|---|
| >d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} | Back information, alignment and structure |
|---|
| >d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} | Back information, alignment and structure |
|---|
| >d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1omoa_ c.2.1.13 (A:) Archaeal alanine dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} | Back information, alignment and structure |
|---|
| >d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} | Back information, alignment and structure |
|---|
| >d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1x7da_ c.2.1.13 (A:) Ornithine cyclodeaminase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1pj3a1 c.2.1.7 (A:280-573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vl6a1 c.2.1.7 (A:155-376) Malate oxidoreductase (malic enzyme) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} | Back information, alignment and structure |
|---|
| >d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} | Back information, alignment and structure |
|---|
| >d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1o0sa1 c.2.1.7 (A:296-603) Mitochondrial NAD(P)-dependent malic enzyme {Pig roundworm (Ascaris suum) [TaxId: 6253]} | Back information, alignment and structure |
|---|
| >d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} | Back information, alignment and structure |
|---|
| >d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pvva2 c.78.1.1 (A:151-313) Ornithine transcarbamoylase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1gq2a1 c.2.1.7 (A:280-580) Mitochondrial NAD(P)-dependent malic enzyme {Domestic pigeon (Columba livia) [TaxId: 8932]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} | Back information, alignment and structure |
|---|
| >d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} | Back information, alignment and structure |
|---|
| >d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mv8a3 c.26.3.1 (A:301-436) GDP-mannose 6-dehydrogenase, GDP-binding domain {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} | Back information, alignment and structure |
|---|
| >d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} | Back information, alignment and structure |
|---|
| >d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} | Back information, alignment and structure |
|---|
| >d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d1np3a2 c.2.1.6 (A:1-182) Class I ketol-acid reductoisomerase (KARI) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} | Back information, alignment and structure |
|---|
| >d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} | Back information, alignment and structure |
|---|
| >d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vlva2 c.78.1.1 (A:153-313) Ornithine transcarbamoylase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} | Back information, alignment and structure |
|---|
| >d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ml4a2 c.78.1.1 (A:152-308) Aspartate carbamoyltransferase catalytic subunit {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1dxha2 c.78.1.1 (A:151-335) Ornithine transcarbamoylase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1otha2 c.78.1.1 (A:185-354) Ornithine transcarbamoylase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pg5a2 c.78.1.1 (A:147-299) Aspartate carbamoyltransferase catalytic subunit {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2at2a2 c.78.1.1 (A:145-295) Aspartate carbamoyltransferase catalytic subunit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} | Back information, alignment and structure |
|---|
| >d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} | Back information, alignment and structure |
|---|
| >d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} | Back information, alignment and structure |
|---|
| >d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} | Back information, alignment and structure |
|---|
| >d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1duvg2 c.78.1.1 (G:151-333) Ornithine transcarbamoylase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} | Back information, alignment and structure |
|---|
| >d2h1qa1 c.67.3.1 (A:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} | Back information, alignment and structure |
|---|
| >d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} | Back information, alignment and structure |
|---|
| >d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} | Back information, alignment and structure |
|---|
| >d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1qmga2 c.2.1.6 (A:82-307) Class II ketol-acid reductoisomerase (KARI) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1dlja3 c.26.3.1 (A:295-402) UDP-glucose dehydrogenase (UDPGDH), C-terminal (UDP-binding) domain {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} | Back information, alignment and structure |
|---|
| >d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1ekxa2 c.78.1.1 (A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} | Back information, alignment and structure |
|---|
| >d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} | Back information, alignment and structure |
|---|
| >d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ax3a2 c.104.1.1 (A:1-211) Hypothetical protein TM0922, N-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} | Back information, alignment and structure |
|---|
| >d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} | Back information, alignment and structure |
|---|
| >d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} | Back information, alignment and structure |
|---|
| >d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} | Back information, alignment and structure |
|---|
| >d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} | Back information, alignment and structure |
|---|
| >d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1vmea1 c.23.5.1 (A:251-398) ROO-like flavoprotein TM0755, C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vkza2 c.30.1.1 (A:4-93) Glycinamide ribonucleotide synthetase (GAR-syn), N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|