Citrus Sinensis ID: 024294


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVLSEADFLKEKLKIEEEERKLEAAIEETEKQNAEVNAELKELELKSKRFKELEERYFFNIY
cccccccccccccccccccccccccccccccEEcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
****************PNVPRWVCQNCRHFLCIVGVDSYADKYLN****************************************************************************************************HSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKEVDDVTRDIEAYEACLQRLEGEARDVL***************************KQNAEVNA*************ELEERYFFNIY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKEDAPDKGRTLSVDPNVPRWVCQNCRHFLCIVGVDSYADKYLNDSSRSTMHGSSIHASNSVLGSTRMDNSFVVLPKQRPQSHGVPPRPRGSSAQSEASQSGKAMDESFVVIYKSESASDGGGPHIPPPEGGTNGPMQPNNSGFHSTITVLKRAFEIATSQTQVEQPLCLECMRVLSDKLDKExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYFFNIY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beclin-1-like protein probableQ9M367

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q8T, chain A
Confidence level:confident
Coverage over the Query: 230-268
View the alignment between query and template
View the model in PyMOL
Template: 2V66, chain B
Confidence level:probable
Coverage over the Query: 179-249
View the alignment between query and template
View the model in PyMOL
Template: 2P1L, chain B
Confidence level:probable
Coverage over the Query: 143-161
View the alignment between query and template
View the model in PyMOL