Citrus Sinensis ID: 024300

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MAPPILSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKGQSPEQFKIVIPKIPAYFTGTGDLMTALLLGWSNKYRDNLDIAAELAVSSLQVLLLLMP
ccccccccccccccccEEEEccccccccccHHHcHHHHHHcccccEEEccEEccccccccccCEEEccHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHHHHHccccEEEEccccccccccccccHHHHHHHHHccccccEEcccHHHHHHHcccccccHHHHHHHHHHHHHccccEEEEccEEccccEEEEEEEEcccccccCEEEEECccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc
**************GRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKGQSPEQFKIVIPKIPAYFTGTGDLMTALLLGWSNKYRDNLDIAAELAVSSLQVLLLLMP
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPILSLALPSETGRVLSIQSHTVQGYVGNKSAVFPLQLLGYDVDPIHSVQFSNHTGYPTFKGQVLNGQQLCDLIEGLEANNLLYYTHLLTGYIGSVSFLNTILQVVEKLRSINPNLIYVCDPVMGDEGKLYVPSELVSVYREKVVPVASMLTPNQFEAEQLTGFRIGSEADGREACKILHAAGPAKVVITSINIDGNLFLIGSHQKEKGQSPEQFKIVIPKIPAYFTGTGDLMTALLLGWSNKYRDNLDIAAELAVSSLQVLLLLMP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal kinase Catalyzes the transfer of a phosphate group from ATP to the 5-hydroxylmethyl group of pyridoxal to form the biologically active pyridoxal phosphate.confidentQ8W1X2
Pyridoxal kinase Required for synthesis of pyridoxal-5-phosphate from vitamin B6.probableQ55EK9
Pyridoxamine kinase Phosphorylates B6 vitamers; functions in a salvage pathway. Uses pyridoxamine.probableA3N2D3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.1.-Phosphotransferases with an alcohol group as acceptor.probable
2.7.1.35Pyridoxal kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YXT, chain A
Confidence level:very confident
Coverage over the Query: 13-267
View the alignment between query and template
View the model in PyMOL