BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024309
(269 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SAE|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
pdb|3SDQ|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
pdb|3SDR|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
pdb|3SDT|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
pdb|3SDU|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
pdb|3SDV|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
Prospective Target For Advanced Biofuels Production
Length = 817
Score = 28.5 bits (62), Expect = 4.1, Method: Composition-based stats.
Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 5/44 (11%)
Query: 134 WLYKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPAITG 177
W Y VHS+ Y + S Y AE+L ++ PAITG
Sbjct: 35 WGYDLVHSLKSPY-----IDSSYRERAEVLVSEIKAMLNPAITG 73
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.328 0.143 0.480
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,052,627
Number of Sequences: 62578
Number of extensions: 382714
Number of successful extensions: 918
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 918
Number of HSP's gapped (non-prelim): 2
length of query: 269
length of database: 14,973,337
effective HSP length: 97
effective length of query: 172
effective length of database: 8,903,271
effective search space: 1531362612
effective search space used: 1531362612
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)