BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024309
         (269 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3SAE|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
 pdb|3SDQ|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
 pdb|3SDR|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
 pdb|3SDT|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
 pdb|3SDU|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
 pdb|3SDV|A Chain A, Structure Of A Three-Domain Sesquiterpene Synthase: A
           Prospective Target For Advanced Biofuels Production
          Length = 817

 Score = 28.5 bits (62), Expect = 4.1,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 134 WLYKHVHSVHHEYATPFGLTSEYAHPAEILFLGFATIVGPAITG 177
           W Y  VHS+   Y     + S Y   AE+L      ++ PAITG
Sbjct: 35  WGYDLVHSLKSPY-----IDSSYRERAEVLVSEIKAMLNPAITG 73


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.143    0.480 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 9,052,627
Number of Sequences: 62578
Number of extensions: 382714
Number of successful extensions: 918
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 918
Number of HSP's gapped (non-prelim): 2
length of query: 269
length of database: 14,973,337
effective HSP length: 97
effective length of query: 172
effective length of database: 8,903,271
effective search space: 1531362612
effective search space used: 1531362612
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 51 (24.3 bits)