Citrus Sinensis ID: 024321


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDHSVN
cccccccccccccccEEccccccccccccccccccccEEEccccccccccccccccccccHHHHHHccccccccccccccccccEEEEEEEccccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHcccccccccEEEEEccccEEEccEEEEEEEcccccccccccccccEEEEcccccccHHHHHHHHHccccEEEEEcccccccccEEEEEccccccccccccEEEcccHHHHHHHHHHHHHccccccccccccccccc
cccHHHHcccccccccccccccccccHHHHHcccccHHHHcccccccccccccccccccHHHHHHHHccccccccccccccEEEEEEEEEEEcccHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHcccccccccccEEEEEccEEEEccEEEEEEccccHHHcccHHHcccEEEEccccccEHHHHcHHHHccccEEEEccccEcccEcEccccccHccccccEEEEEEcccHHHHHHHHHHHHHHHHHcEEEEEEcccccc
mashsalapsripaitripsktthsfptqcstkrLDVAEFAGlranagatyatgardasffDAVTAqltpkvaagsvpvkKETVAKLKVAINGFGrigrnflrcwhgrkdspldVVVVNdsggvknashLLKYDSLlgtfkadvkivdnetisvdgklikvvsnrdplqlpwaelgIDIViegtgvfvdgpgagkhiQAGAKKVIItapakgadiptyvvgvnekdydhevANIVsnascttnclapfvkvmdeelgkqsdllndhsvn
mashsalapsripaitripsktthsfptqcstKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLtpkvaagsvpvkketVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVkivdnetisvdgklikvvsnrdplqlpWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEelgkqsdllndhsvn
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDHSVN
*****************************CSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMD****************
************************************************************************************AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDHS**
*********SRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDHSVN
*******************************************************************************KKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDH***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELGKQSDLLNDHSVN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query269 2.2.26 [Sep-21-2011]
P12859 451 Glyceraldehyde-3-phosphat N/A no 0.951 0.567 0.793 1e-119
P12860 451 Glyceraldehyde-3-phosphat N/A no 0.940 0.560 0.810 1e-118
P25857 447 Glyceraldehyde-3-phosphat yes no 0.933 0.561 0.798 1e-118
P09044 438 Glyceraldehyde-3-phosphat N/A no 0.836 0.513 0.850 1e-110
P50362 374 Glyceraldehyde-3-phosphat N/A no 0.684 0.491 0.732 5e-76
P09315 403 Glyceraldehyde-3-phosphat N/A no 0.810 0.540 0.662 8e-76
P19866 401 Glyceraldehyde-3-phosphat N/A no 0.799 0.536 0.663 9e-76
P25856 396 Glyceraldehyde-3-phosphat no no 0.799 0.542 0.669 2e-75
P09043 392 Glyceraldehyde-3-phosphat N/A no 0.795 0.545 0.651 1e-73
P12858 405 Glyceraldehyde-3-phosphat N/A no 0.799 0.530 0.642 3e-73
>sp|P12859|G3PB_PEA Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Pisum sativum GN=GAPB PE=2 SV=2 Back     alignment and function desciption
 Score =  429 bits (1102), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 204/257 (79%), Positives = 233/257 (90%), Gaps = 1/257 (0%)

Query: 1   MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
           MA+H+ALA +RIP  TR PSKT+HSFP+QC++KRL+V EF+GL++ +  +Y   ARD+SF
Sbjct: 1   MATHAALASTRIPTNTRFPSKTSHSFPSQCASKRLEVGEFSGLKSTSCISYVHSARDSSF 60

Query: 61  FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
           +D V AQLT K A GS  VK  TVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+V+VVND
Sbjct: 61  YDVVAAQLTSK-ANGSTAVKGVTVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVIVVND 119

Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
           SGGVKNASHLLKYDS+LGTFKA+VKI++NETI+VDGK IKVVS+RDPL+LPWAELGIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKAEVKILNNETITVDGKPIKVVSSRDPLKLPWAELGIDIV 179

Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASC 240
           IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYV+GVNE+DY HEVA+I+SNASC
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVIGVNEQDYGHEVADIISNASC 239

Query: 241 TTNCLAPFVKVMDEELG 257
           TTNCLAPF KV+DEE G
Sbjct: 240 TTNCLAPFAKVLDEEFG 256





Pisum sativum (taxid: 3888)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 3
>sp|P12860|G3PB_SPIOL Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Spinacia oleracea GN=GAPB PE=1 SV=1 Back     alignment and function description
>sp|P25857|G3PB_ARATH Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic OS=Arabidopsis thaliana GN=GAPB PE=1 SV=2 Back     alignment and function description
>sp|P09044|G3PB_TOBAC Glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPB PE=2 SV=1 Back     alignment and function description
>sp|P50362|G3PA_CHLRE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Chlamydomonas reinhardtii GN=GAPA PE=1 SV=1 Back     alignment and function description
>sp|P09315|G3PA_MAIZE Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Zea mays GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P19866|G3PA_SPIOL Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Spinacia oleracea GN=GAPA PE=1 SV=2 Back     alignment and function description
>sp|P25856|G3PA_ARATH Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Arabidopsis thaliana GN=GAPA PE=1 SV=3 Back     alignment and function description
>sp|P09043|G3PA_TOBAC Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GAPA PE=2 SV=1 Back     alignment and function description
>sp|P12858|G3PA_PEA Glyceraldehyde-3-phosphate dehydrogenase A, chloroplastic OS=Pisum sativum GN=GAPA PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
255539282 458 glyceraldehyde 3-phosphate dehydrogenase 0.951 0.558 0.867 1e-128
224086078 452 predicted protein [Populus trichocarpa] 0.951 0.566 0.856 1e-125
381393062 452 glyceraldehyde-3-phosphate dehydrogenase 0.951 0.566 0.828 1e-123
224061855 440 predicted protein [Populus trichocarpa] 0.910 0.556 0.869 1e-122
351726690 451 glyceraldehyde-3-phosphate dehydrogenase 0.951 0.567 0.813 1e-122
255641007 452 unknown [Glycine max] 0.955 0.568 0.801 1e-121
358248146 451 uncharacterized protein LOC100806482 [Gl 0.951 0.567 0.813 1e-121
327198779 450 glyceraldehyde-3-phosphate dehydrogenase 0.947 0.566 0.821 1e-121
449455619 451 PREDICTED: glyceraldehyde-3-phosphate de 0.947 0.565 0.836 1e-121
147795191 453 hypothetical protein VITISV_021576 [Viti 0.951 0.565 0.833 1e-120
>gi|255539282|ref|XP_002510706.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] gi|223551407|gb|EEF52893.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  462 bits (1188), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/257 (86%), Positives = 238/257 (92%), Gaps = 1/257 (0%)

Query: 1   MASHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASF 60
           MA+H+ALAPSRIPA TR+PSK+ HSFPTQCS+KRL+VAEF+GLRA++  TYA  A +ASF
Sbjct: 1   MATHAALAPSRIPASTRLPSKSAHSFPTQCSSKRLEVAEFSGLRASSCMTYAKNASEASF 60

Query: 61  FDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVND 120
           FD V AQ+ PKVA  S P + ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDV+VVND
Sbjct: 61  FDLVAAQMAPKVAT-STPTRAETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVIVVND 119

Query: 121 SGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIV 180
           SGGVKNASHLLKYDS+LGTFKADVKIVDN TISVDGK IKVVSNRDPL+LPWAELGIDIV
Sbjct: 120 SGGVKNASHLLKYDSMLGTFKADVKIVDNTTISVDGKPIKVVSNRDPLKLPWAELGIDIV 179

Query: 181 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASC 240
           IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDY HEVANIVSNASC
Sbjct: 180 IEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYSHEVANIVSNASC 239

Query: 241 TTNCLAPFVKVMDEELG 257
           TTNCLAPFVKVMDEE G
Sbjct: 240 TTNCLAPFVKVMDEEFG 256




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224086078|ref|XP_002307806.1| predicted protein [Populus trichocarpa] gi|222857255|gb|EEE94802.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|381393062|gb|AFG28405.1| glyceraldehyde-3-phosphate dehydrogenase B [Pyrus x bretschneideri] Back     alignment and taxonomy information
>gi|224061855|ref|XP_002300632.1| predicted protein [Populus trichocarpa] gi|222842358|gb|EEE79905.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|351726690|ref|NP_001237135.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] gi|77540212|gb|ABA86964.1| glyceraldehyde-3-phosphate dehydrogenase B subunit [Glycine max] Back     alignment and taxonomy information
>gi|255641007|gb|ACU20783.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|358248146|ref|NP_001240080.1| uncharacterized protein LOC100806482 [Glycine max] gi|255636463|gb|ACU18570.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|327198779|emb|CBL43264.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum] Back     alignment and taxonomy information
>gi|449455619|ref|XP_004145550.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] gi|449485095|ref|XP_004157068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase B, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|147795191|emb|CAN69459.1| hypothetical protein VITISV_021576 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query269
TAIR|locus:2009864 447 GAPB "glyceraldehyde-3-phospha 0.970 0.583 0.776 2.1e-107
TAIR|locus:2010361 399 GAPA-2 "glyceraldehyde 3-phosp 0.806 0.543 0.659 3.2e-72
TAIR|locus:2090802 396 GAPA "glyceraldehyde 3-phospha 0.799 0.542 0.669 4.8e-71
UNIPROTKB|Q829W3 335 gap2 "Glyceraldehyde-3-phospha 0.624 0.501 0.538 6.4e-44
TAIR|locus:2032810 420 GAPCP-2 "glyceraldehyde-3-phos 0.895 0.573 0.427 2.5e-42
TAIR|locus:2206435 422 GAPCP-1 "glyceraldehyde-3-phos 0.910 0.580 0.422 2.5e-42
TIGR_CMR|CHY_0280 335 CHY_0280 "glyceraldehyde-3-pho 0.657 0.528 0.521 4e-42
TIGR_CMR|BA_5369 334 BA_5369 "glyceraldehyde 3-phos 0.654 0.526 0.502 8.4e-42
TIGR_CMR|BA_4827 342 BA_4827 "glyceraldehyde 3-phos 0.639 0.502 0.488 1.6e-40
CGD|CAL0005657 335 TDH3 [Candida albicans (taxid: 0.654 0.525 0.505 3.3e-40
TAIR|locus:2009864 GAPB "glyceraldehyde-3-phosphate dehydrogenase B subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1062 (378.9 bits), Expect = 2.1e-107, P = 2.1e-107
 Identities = 209/269 (77%), Positives = 233/269 (86%)

Query:     1 MASHSALAPSRIPAITRIPSKTT-HSFPTQCSTKRLDVAEFAGLRANAGATYATGARDAS 59
             MA+H+ALA SRIP   R+ SK+  HSFP QCS+KRL+VAEF+GLR ++      G  +AS
Sbjct:     1 MATHAALAVSRIPVTQRLQSKSAIHSFPAQCSSKRLEVAEFSGLRMSS-----IGG-EAS 54

Query:    60 FFDAVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVN 119
             FFDAV AQ+ PK    S PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPL+VVV+N
Sbjct:    55 FFDAVAAQIIPKAVTTSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLEVVVLN 114

Query:   120 DSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDI 179
             DSGGVKNASHLLKYDS+LGTFKA+VKIVDNETISVDGKLIKVVSNRDPL+LPWAELGIDI
Sbjct:   115 DSGGVKNASHLLKYDSMLGTFKAEVKIVDNETISVDGKLIKVVSNRDPLKLPWAELGIDI 174

Query:   180 VIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNAS 239
             VIEGTGVFVDGPGAGKHIQAGA KVIITAPAKGADIPTYV+GVNE+DY H+VANI+SNAS
Sbjct:   175 VIEGTGVFVDGPGAGKHIQAGASKVIITAPAKGADIPTYVMGVNEQDYGHDVANIISNAS 234

Query:   240 CTTNCLAPFVKVMDEELG-KQSDLLNDHS 267
             CTTNCLAPF KV+DEE G  +  +   HS
Sbjct:   235 CTTNCLAPFAKVLDEEFGIVKGTMTTTHS 263




GO:0000166 "nucleotide binding" evidence=IEA
GO:0006006 "glucose metabolic process" evidence=IEA
GO:0006096 "glycolysis" evidence=ISS
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051287 "NAD binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0009941 "chloroplast envelope" evidence=IDA
GO:0047100 "glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating) activity" evidence=ISS
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009416 "response to light stimulus" evidence=IEP;RCA
GO:0009744 "response to sucrose stimulus" evidence=IEP;RCA
GO:0019253 "reductive pentose-phosphate cycle" evidence=NAS
GO:0009570 "chloroplast stroma" evidence=IDA
GO:0004365 "glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity" evidence=NAS
GO:0046686 "response to cadmium ion" evidence=IEP;RCA
GO:0009409 "response to cold" evidence=IEP;RCA
GO:0010319 "stromule" evidence=IDA
GO:0016020 "membrane" evidence=IDA
GO:0048046 "apoplast" evidence=IDA
GO:0005829 "cytosol" evidence=RCA
GO:0006098 "pentose-phosphate shunt" evidence=RCA
GO:0006364 "rRNA processing" evidence=RCA
GO:0006636 "unsaturated fatty acid biosynthetic process" evidence=RCA
GO:0009637 "response to blue light" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0009657 "plastid organization" evidence=RCA
GO:0009749 "response to glucose stimulus" evidence=RCA
GO:0009773 "photosynthetic electron transport in photosystem I" evidence=RCA
GO:0009902 "chloroplast relocation" evidence=RCA
GO:0010114 "response to red light" evidence=RCA
GO:0010155 "regulation of proton transport" evidence=RCA
GO:0010207 "photosystem II assembly" evidence=RCA
GO:0010218 "response to far red light" evidence=RCA
GO:0010304 "PSII associated light-harvesting complex II catabolic process" evidence=RCA
GO:0015994 "chlorophyll metabolic process" evidence=RCA
GO:0015995 "chlorophyll biosynthetic process" evidence=RCA
GO:0019216 "regulation of lipid metabolic process" evidence=RCA
GO:0019288 "isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway" evidence=RCA
GO:0019344 "cysteine biosynthetic process" evidence=RCA
GO:0031408 "oxylipin biosynthetic process" evidence=RCA
GO:0042742 "defense response to bacterium" evidence=RCA
GO:0042744 "hydrogen peroxide catabolic process" evidence=RCA
TAIR|locus:2010361 GAPA-2 "glyceraldehyde 3-phosphate dehydrogenase A subunit 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2090802 GAPA "glyceraldehyde 3-phosphate dehydrogenase A subunit" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q829W3 gap2 "Glyceraldehyde-3-phosphate dehydrogenase" [Streptomyces avermitilis MA-4680 (taxid:227882)] Back     alignment and assigned GO terms
TAIR|locus:2032810 GAPCP-2 "glyceraldehyde-3-phosphate dehydrogenase of plastid 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2206435 GAPCP-1 "glyceraldehyde-3-phosphate dehydrogenase of plastid 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|CHY_0280 CHY_0280 "glyceraldehyde-3-phosphate dehydrogenase, type I" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] Back     alignment and assigned GO terms
TIGR_CMR|BA_5369 BA_5369 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|BA_4827 BA_4827 "glyceraldehyde 3-phosphate dehydrogenase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
CGD|CAL0005657 TDH3 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P25857G3PB_ARATH1, ., 2, ., 1, ., 1, 30.79840.93300.5615yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.921

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
PLN02237 442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 1e-154
PLN03096 395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 1e-112
PRK07403 337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 3e-82
TIGR01534 326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 3e-71
PRK07729 343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 4e-69
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 2e-68
COG0057 335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 6e-67
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 6e-65
PLN02272 421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 5e-57
PRK13535 336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 3e-46
PTZ00023 337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 5e-45
PRK15425 331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 2e-40
TIGR01532 325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 2e-40
PLN02358 338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 3e-40
PTZ00434 361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 6e-39
PRK08955 334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 8e-37
PRK08289 477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 2e-33
PTZ00353 342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-11
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
 Score =  437 bits (1125), Expect = e-154
 Identities = 214/255 (83%), Positives = 230/255 (90%), Gaps = 9/255 (3%)

Query: 3   SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFD 62
           +H+ALA SRIPA TR+PSK +H        KRL+VAEF+GLRA++  T+A  AR+ASFFD
Sbjct: 1   THAALASSRIPATTRLPSKASH--------KRLEVAEFSGLRASSCVTFAKNAREASFFD 52

Query: 63  AVTAQLTPKVAAGSVPVKKETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 122
            V +QL PK  AGS PV+ ETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG
Sbjct: 53  VVASQLAPK-VAGSTPVRGETVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSG 111

Query: 123 GVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIE 182
           GVKNASHLLKYDS+LGTFKADVKIVD+ETISVDGK IKVVSNRDPL+LPWAELGIDIVIE
Sbjct: 112 GVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVVSNRDPLKLPWAELGIDIVIE 171

Query: 183 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT 242
           GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNE DYDHEVANIVSNASCTT
Sbjct: 172 GTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT 231

Query: 243 NCLAPFVKVMDEELG 257
           NCLAPFVKV+DEE G
Sbjct: 232 NCLAPFVKVLDEEFG 246


Length = 442

>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 269
PLN02237 442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PLN03096 395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PTZ00434 361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PRK08289 477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PRK07403 337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PTZ00023 337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PRK15425 331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
COG0057 335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
PRK07729 343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PTZ00353 342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
TIGR01534 327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PLN02272 421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK13535 336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
PRK08955 334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PLN02358 338 glyceraldehyde-3-phosphate dehydrogenase 100.0
TIGR01532 325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 100.0
KOG0657 285 consensus Glyceraldehyde 3-phosphate dehydrogenase 100.0
TIGR01546 333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
PRK04207 341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 99.98
PRK06901 322 aspartate-semialdehyde dehydrogenase; Provisional 99.92
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 99.89
COG0136 334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 99.86
TIGR01296 339 asd_B aspartate-semialdehyde dehydrogenase (peptid 99.86
TIGR01745 366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 99.86
PRK06728 347 aspartate-semialdehyde dehydrogenase; Provisional 99.77
PRK08040 336 putative semialdehyde dehydrogenase; Provisional 99.77
PRK06598 369 aspartate-semialdehyde dehydrogenase; Reviewed 99.76
PRK05671 336 aspartate-semialdehyde dehydrogenase; Reviewed 99.69
PLN02383 344 aspartate semialdehyde dehydrogenase 99.69
PRK08664 349 aspartate-semialdehyde dehydrogenase; Reviewed 99.65
TIGR00978 341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 99.65
PRK00436 343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 99.49
TIGR01850 346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 99.41
PRK11863 313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 99.35
PLN02968 381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 99.32
PRK08300 302 acetaldehyde dehydrogenase; Validated 99.3
KOG4777 361 consensus Aspartate-semialdehyde dehydrogenase [Am 99.23
TIGR01851 310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 99.12
TIGR03215 285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.0
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 98.7
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 97.86
PRK13301 267 putative L-aspartate dehydrogenase; Provisional 97.81
COG0002 349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 97.61
PRK13303 265 L-aspartate dehydrogenase; Provisional 97.49
TIGR00036 266 dapB dihydrodipicolinate reductase. 97.37
PRK06270 341 homoserine dehydrogenase; Provisional 97.22
TIGR01921 324 DAP-DH diaminopimelate dehydrogenase. This model r 97.07
PRK13304 265 L-aspartate dehydrogenase; Reviewed 97.03
COG1712 255 Predicted dinucleotide-utilizing enzyme [General f 96.96
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 96.93
PRK13302 271 putative L-aspartate dehydrogenase; Provisional 96.92
PRK00048257 dihydrodipicolinate reductase; Provisional 96.87
PRK08374 336 homoserine dehydrogenase; Provisional 96.84
PRK06392 326 homoserine dehydrogenase; Provisional 96.82
PRK06813 346 homoserine dehydrogenase; Validated 96.77
COG0460 333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.73
PRK06349 426 homoserine dehydrogenase; Provisional 96.55
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.04
COG2344211 AT-rich DNA-binding protein [General function pred 96.01
COG0289 266 DapB Dihydrodipicolinate reductase [Amino acid tra 96.0
PRK11579 346 putative oxidoreductase; Provisional 95.93
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 95.74
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.17
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.75
PRK09414445 glutamate dehydrogenase; Provisional 94.65
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 94.64
PLN02700 377 homoserine dehydrogenase family protein 94.46
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.46
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 94.45
PLN02775286 Probable dihydrodipicolinate reductase 94.19
COG4091 438 Predicted homoserine dehydrogenase [Amino acid tra 94.16
PRK09466 810 metL bifunctional aspartate kinase II/homoserine d 93.95
COG4569 310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 93.78
PRK10206 344 putative oxidoreductase; Provisional 93.53
PRK09436 819 thrA bifunctional aspartokinase I/homoserine dehyd 93.38
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 93.37
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 92.86
COG0569225 TrkA K+ transport systems, NAD-binding component [ 92.77
PLN02477410 glutamate dehydrogenase 92.76
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.66
PRK06487317 glycerate dehydrogenase; Provisional 92.12
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.69
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 91.51
PRK06932314 glycerate dehydrogenase; Provisional 91.45
COG0673 342 MviM Predicted dehydrogenases and related proteins 91.32
PRK14030445 glutamate dehydrogenase; Provisional 91.18
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 90.87
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 90.86
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 90.75
PLN02928347 oxidoreductase family protein 90.49
CHL00194 317 ycf39 Ycf39; Provisional 90.25
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 90.19
PRK07574385 formate dehydrogenase; Provisional 90.11
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 90.11
PRK13243333 glyoxylate reductase; Reviewed 90.08
PRK06436303 glycerate dehydrogenase; Provisional 90.01
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 89.07
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 88.73
PLN02306386 hydroxypyruvate reductase 88.68
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 88.49
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 88.41
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 88.31
PLN00016 378 RNA-binding protein; Provisional 88.12
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 88.04
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 87.77
PLN03139386 formate dehydrogenase; Provisional 87.76
COG2910211 Putative NADH-flavin reductase [General function p 87.74
PRK12480330 D-lactate dehydrogenase; Provisional 87.66
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 87.6
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 87.5
PTZ00117 319 malate dehydrogenase; Provisional 87.13
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 86.66
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 86.38
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 86.17
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 86.11
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 86.01
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 85.77
PLN02256304 arogenate dehydrogenase 85.64
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 84.88
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 84.76
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 84.41
PRK13581 526 D-3-phosphoglycerate dehydrogenase; Provisional 84.37
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 84.23
KOG1502 327 consensus Flavonol reductase/cinnamoyl-CoA reducta 84.07
PRK14031444 glutamate dehydrogenase; Provisional 83.73
PRK08605332 D-lactate dehydrogenase; Validated 83.66
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 83.44
PRK11559 296 garR tartronate semialdehyde reductase; Provisiona 83.15
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 83.11
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 82.86
PRK13403 335 ketol-acid reductoisomerase; Provisional 82.36
COG3804 350 Uncharacterized conserved protein related to dihyd 82.12
cd01483143 E1_enzyme_family Superfamily of activating enzymes 81.41
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 81.2
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 81.17
PRK07417279 arogenate dehydrogenase; Reviewed 80.93
PTZ00082 321 L-lactate dehydrogenase; Provisional 80.6
KOG2741 351 consensus Dimeric dihydrodiol dehydrogenase [Carbo 80.25
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transpor 80.23
cd05293 312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 80.13
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
Probab=100.00  E-value=6.4e-74  Score=554.34  Aligned_cols=257  Identities=84%  Similarity=1.262  Sum_probs=235.3

Q ss_pred             ccCCCCCCCCCcccccCCCCCCCCCCcccccccccccccCcccccccccccccCCCCHHHHHHHhhcccccCCCCCcccc
Q 024321            3 SHSALAPSRIPAITRIPSKTTHSFPTQCSTKRLDVAEFAGLRANAGATYATGARDASFFDAVTAQLTPKVAAGSVPVKKE   82 (269)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   82 (269)
                      +|||||++|||+++|++|+++        .++.+|++|+|||++++++|.....+.+|.+.++.++..+..+ ....+.+
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~~--------~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~   71 (442)
T PLN02237          1 THAALASSRIPATTRLPSKAS--------HKRLEVAEFSGLRASSCVTFAKNAREASFFDVVASQLAPKVAG-STPVRGE   71 (442)
T ss_pred             CcchhcccCCccccccccccc--------cccccccccccccccccccccccccchhHHHHhhhhhhhhhcc-ccccccc
Confidence            699999999999999999886        2667899999999999999977777889999999998775333 5566667


Q ss_pred             ccceeeEEEEcCChHHHHHHHHHHhCCCCCceEEEEcCCCCcccccccccccccccccCceEEEecCCeEEECCEEEEEE
Q 024321           83 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVV  162 (269)
Q Consensus        83 ~~~~ikVaInGfGrIGR~llR~l~~r~~~~l~iVaInd~~~~~~~a~LlkyDS~hG~f~g~v~~~~~~~L~inGk~I~V~  162 (269)
                      ++|++||||||||||||+++|+++++.+++++||+|||+.++++++|||||||+||+|+++|++.+++.|.+||+.|+|+
T Consensus        72 ~~~~ikVgINGFGRIGR~vlR~~~~~~~~~ievVaINd~~~~~~~ayLlkyDS~hG~f~~~v~~~~~~~L~v~Gk~I~V~  151 (442)
T PLN02237         72 TVAKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSMLGTFKADVKIVDDETISVDGKPIKVV  151 (442)
T ss_pred             ccceEEEEEECCChHHHHHHHHHHHccCCCeEEEEECCCCCHHHHHHHHccccCCCCcCCceEECCCCEEEECCEEEEEE
Confidence            88989999999999999999998876435799999999999999999999999999999999864578899999999999


Q ss_pred             ecCCCCCCCCCCCCccEEEEcCCCCCChhhHHHHHHcCCCEEEEecCCCCCCCCeEEeecCccccCCCCCceEEcCChhH
Q 024321          163 SNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTT  242 (269)
Q Consensus       163 ~~~~P~~i~w~~~gvDiVve~TG~f~~~e~a~~Hl~aGakkVIISAP~k~~Dip~iV~GVN~~~~~~~~~~IISnaSCTT  242 (269)
                      ++++|.++||+++|+||||||||.|+++++++.|+++|||||+||+|++++|+|+||||||++.|++..++|||||||||
T Consensus       152 ~~~dp~~l~W~~~gVDiViE~TG~f~s~e~a~~hl~aGAkkV~iSAP~~d~dvptvV~GVN~~~~~~~~~~IISnaSCTT  231 (442)
T PLN02237        152 SNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEDDYDHEVANIVSNASCTT  231 (442)
T ss_pred             EcCCchhCChhhcCCCEEEEccChhhhHHHHHHHHhCCCEEEEECCCCCCCCCceEecccCHHHhCcCCCCEEECCchHH
Confidence            99999999999999999999999999999999999999999999999988778999999999999863368999999999


Q ss_pred             HhHHHHHHHHhhhcCceEEEEee-ecc
Q 024321          243 NCLAPFVKVMDEELGKQSDLLND-HSV  268 (269)
Q Consensus       243 n~LaPvlkvL~d~fGI~~g~vTT-hsv  268 (269)
                      |||+|++|+|||+|||++++||| ||+
T Consensus       232 NcLAPvlkvL~d~fGI~~g~mTTvHs~  258 (442)
T PLN02237        232 NCLAPFVKVLDEEFGIVKGTMTTTHSY  258 (442)
T ss_pred             HHHHHHHHHHHHhcCeeEEEEEEEEec
Confidence            99999999999999999999999 986



>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>KOG0657 consensus Glyceraldehyde 3-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>KOG4777 consensus Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>KOG2741 consensus Dimeric dihydrodiol dehydrogenase [Carbohydrate transport and metabolism; Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG0287 TyrA Prephenate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
2pkq_O 368 Crystal Structure Of The Photosynthetic A2b2-Glycer 2e-92
1nbo_O 337 The Dual Coenzyme Specificity Of Photosynthetic Gly 6e-76
1rm5_O 337 Crystal Structure Of Mutant S188a Of Photosynthetic 6e-76
1rm3_O 337 Crystal Structure Of Mutant T33a Of Photosynthetic 6e-76
2pkr_O 365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 1e-75
3k2b_A 337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 1e-73
1jn0_O 335 Crystal Structure Of The Non-Regulatory A4 Isoform 6e-72
3b1j_A 339 Crystal Structure Of Dehydrogenese Length = 339 6e-59
2d2i_A 380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 4e-58
2ep7_A 342 Structural Study Of Project Id Aq_1065 From Aquifex 1e-49
3dbv_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-45
1gd1_O 334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 2e-43
1cer_O 331 Determinants Of Enzyme Thermostability Observed In 2e-43
4dib_A 345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 7e-43
1dbv_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 1e-42
1npt_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-42
1nq5_O 334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 3e-42
2g82_O 331 High Resolution Structures Of Thermus Aquaticus Gly 4e-42
1vc2_A 331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 4e-42
1hdg_O 332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 4e-42
2i5p_O 342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-40
3hja_A 356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-40
3l0d_A 356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 7e-40
3gnq_A 344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-39
1vsu_A 359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 4e-37
1obf_O 335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 5e-37
3doc_A 335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 6e-37
3cps_A 354 Crystal Structure Of Cryptosporidium Parvum Glycera 7e-37
1s7c_A 331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 4e-36
1gae_O 330 Comparison Of The Structures Of Wild Type And A N31 4e-36
1gad_O 330 Comparison Of The Structures Of Wild Type And A N31 4e-36
3pym_A 332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 4e-36
4iq8_A 340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 4e-36
3cif_A 359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 6e-36
3e5r_O 337 Crystal Structure And Functional Analysis Of Glycer 4e-35
1dc4_A 330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 4e-35
3e6a_O 336 Crystal Structure And Functional Analysis Of Glycer 5e-35
2vyn_A 331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 6e-35
1ywg_O 337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 7e-35
2b4r_O 345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 7e-35
3k73_Q 336 Crystal Structure Of Phosphate Bound Holo Glycerald 7e-34
3lc1_P 336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 8e-34
3lc7_O 339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 8e-34
3vaz_P 344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 8e-34
3lvf_P 338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 8e-34
1u8f_O 335 Crystal Structure Of Human Placental Glyceraldehyde 3e-33
1znq_O 338 Crsytal Structure Of Human Liver Gapdh Length = 338 3e-33
3h9e_B 346 Crystal Structure Of Human Sperm-Specific Glycerald 3e-33
3ksd_Q 336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 1e-32
3hq4_R 336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 1e-32
1gyp_A 358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 2e-32
1a7k_A 360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 2e-32
3k9q_Q 336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-32
2x0n_A 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-32
1k3t_A 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-32
1ihx_A 333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 5e-32
1j0x_O 332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 7e-32
1gpd_G 334 Studies Of Asymmetry In The Three-Dimensional Struc 1e-31
4gpd_1 333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 1e-31
1szj_G 333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 1e-31
3gpd_R 334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 4e-31
3dmt_C 359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 7e-31
2xf8_A 338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 9e-31
2x5j_O 339 Crystal Structure Of The Apoform Of The D-Erythrose 9e-31
2vyn_D 334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 2e-30
1dss_G 333 Structure Of Active-Site Carboxymethylated D-Glycer 3e-30
3sth_A 361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-29
2x5k_O 339 Structure Of An Active Site Mutant Of The D-Erythro 2e-28
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure

Iteration: 1

Score = 335 bits (858), Expect = 2e-92, Method: Compositional matrix adjust. Identities = 159/172 (92%), Positives = 169/172 (98%) Query: 86 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVK+A+HLLKYDS+LGTFKADVK Sbjct: 1 KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKSATHLLKYDSILGTFKADVK 60 Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205 I+DNET S+DGK IKVVSNRDPL+LPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI Sbjct: 61 IIDNETFSIDGKPIKVVSNRDPLKLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 120 Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELG 257 ITAPAKG+DIPTYVVGVNEKDY H+VANI+SNASCTTNCLAPFVKV+DEELG Sbjct: 121 ITAPAKGSDIPTYVVGVNEKDYGHDVANIISNASCTTNCLAPFVKVLDEELG 172
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query269
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 1e-105
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 1e-104
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 1e-103
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 5e-99
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 7e-99
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 7e-99
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 3e-98
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 3e-98
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 9e-98
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 4e-95
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 6e-95
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 8e-93
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 6e-84
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 1e-78
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 2e-77
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 2e-76
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 1e-75
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 5e-75
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 9e-75
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 9e-75
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 4e-73
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 4e-49
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 2e-48
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 5e-45
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 6e-34
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
 Score =  307 bits (788), Expect = e-105
 Identities = 101/172 (58%), Positives = 132/172 (76%), Gaps = 1/172 (0%)

Query: 86  KLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVK 145
            ++VAINGFGRIGRNFLRCW GR+++ L+VV +N++   + A+HLL+YDS+LG F AD+ 
Sbjct: 2   TIRVAINGFGRIGRNFLRCWFGRQNTDLEVVAINNTSDARTAAHLLEYDSVLGRFNADIS 61

Query: 146 IVDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVI 205
             D  +I+V+GK +K+V +R+PL LPW E  ID+VIE TGVFV   GA KHIQAGAKKV+
Sbjct: 62  -YDENSITVNGKTMKIVCDRNPLNLPWKEWDIDLVIESTGVFVTAEGASKHIQAGAKKVL 120

Query: 206 ITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMDEELG 257
           ITAP KG  + TYV+GVN+ +Y HE   ++SNASCTTNCLAP  KV+ +  G
Sbjct: 121 ITAPGKGEGVGTYVIGVNDSEYRHEDFAVISNASCTTNCLAPVAKVLHDNFG 172


>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
3lvf_P 338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3doc_A 335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
4dib_A 345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3pym_A 332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3ids_C 359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3h9e_O 346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
3hja_A 356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
1obf_O 335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2b4r_O 345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
2ep7_A 342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2g82_O 331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
2d2i_A 380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1rm4_O 337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3b1j_A 339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3cmc_O 334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3cps_A 354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
1gad_O 330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
1hdg_O 332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2x5j_O 339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
3e5r_O 337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1u8f_O 335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2yyy_A 343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
1cf2_P 337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 99.97
2yv3_A 331 Aspartate-semialdehyde dehydrogenase; aspartate pa 99.96
1b7g_O 340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 99.96
2r00_A 336 Aspartate-semialdehyde dehydrogenase; conformation 99.96
2czc_A 334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 99.96
2hjs_A 340 USG-1 protein homolog; aspartate-semialdehyde dehy 99.96
1t4b_A 367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 99.94
2ep5_A 350 350AA long hypothetical aspartate-semialdehyde deh 99.92
3pwk_A 366 Aspartate-semialdehyde dehydrogenase; NADP binding 99.92
1xyg_A 359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 99.92
1ys4_A 354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 99.91
3tz6_A 344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 99.91
2ozp_A 345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 99.91
3pzr_A 370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 99.91
3uw3_A 377 Aspartate-semialdehyde dehydrogenase; structural g 99.9
4dpk_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.85
4dpl_A 359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 99.85
2nqt_A 352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 99.82
3hsk_A 381 Aspartate-semialdehyde dehydrogenase; candida albi 99.82
3dr3_A 337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 99.78
1vkn_A 351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 99.6
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 97.75
1f06_A 320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.62
3bio_A 304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.22
3ohs_X 334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.19
2ejw_A 332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.03
4hkt_A 331 Inositol 2-dehydrogenase; structural genomics, nys 96.98
3ezy_A 344 Dehydrogenase; structural genomics, unknown functi 96.95
3mz0_A 344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 96.93
3i23_A 349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.92
3ijp_A 288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 96.89
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 96.89
3kux_A 352 Putative oxidoreductase; oxidoreductase family, cs 96.85
3ing_A 325 Homoserine dehydrogenase; NP_394635.1, structural 96.81
3euw_A 344 MYO-inositol dehydrogenase; protein structure init 96.77
3gdo_A 358 Uncharacterized oxidoreductase YVAA; structural ge 96.76
3ec7_A 357 Putative dehydrogenase; alpha-beta, structural gen 96.75
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 96.74
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 96.74
3evn_A 329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.73
3e18_A 359 Oxidoreductase; dehydrogenase, NAD-binding, struct 96.71
3f4l_A 345 Putative oxidoreductase YHHX; structural genomics, 96.69
3fhl_A 362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.69
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 96.66
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.65
2ho3_A 325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 96.63
3e9m_A 330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.61
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.59
3e82_A 364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 96.58
3db2_A 354 Putative NADPH-dependent oxidoreductase; two domai 96.58
3mtj_A 444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 96.57
3c8m_A 331 Homoserine dehydrogenase; structural genomics, APC 96.57
3c1a_A 315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.52
1ydw_A 362 AX110P-like protein; structural genomics, protein 96.51
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 96.5
3do5_A 327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.47
4had_A 350 Probable oxidoreductase protein; structural genomi 96.42
1tlt_A 319 Putative oxidoreductase (virulence factor MVIM HO; 96.39
3q2i_A 354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.33
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 96.31
3rc1_A 350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 96.31
4gqa_A 412 NAD binding oxidoreductase; structural genomics, P 96.25
1xea_A 323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.12
1h6d_A 433 Precursor form of glucose-fructose oxidoreductase; 96.11
3upl_A 446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.07
4fb5_A 393 Probable oxidoreductase protein; PSI-biology, nysg 96.05
1dih_A 273 Dihydrodipicolinate reductase; oxidoreductase; HET 95.94
2ixa_A 444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 95.91
3m2t_A 359 Probable dehydrogenase; PSI, SGXNY, structural gen 95.87
3moi_A 387 Probable dehydrogenase; structural genomics, PSI2, 95.84
3uuw_A 308 Putative oxidoreductase with NAD(P)-binding rossm 95.82
1zh8_A 340 Oxidoreductase; TM0312, structural genomics, JO ce 95.73
4ew6_A 330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 95.59
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 95.53
1lc0_A 294 Biliverdin reductase A; oxidoreductase, tetrapyrro 95.42
4h3v_A 390 Oxidoreductase domain protein; structural genomics 95.4
2glx_A 332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 95.26
3o9z_A 312 Lipopolysaccaride biosynthesis protein WBPB; oxido 94.85
3ip3_A 337 Oxidoreductase, putative; structural genomics, PSI 94.72
3oa2_A 318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 94.71
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 94.6
2p2s_A 336 Putative oxidoreductase; YP_050235.1, structural g 94.53
3u3x_A 361 Oxidoreductase; structural genomics, PSI-biology, 93.91
3v5n_A 417 Oxidoreductase; structural genomics, PSI-biology, 93.77
1ebf_A 358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 93.58
2nvw_A 479 Galactose/lactose metabolism regulatory protein GA 93.53
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 93.36
3btv_A 438 Galactose/lactose metabolism regulatory protein GA 93.27
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 93.04
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.77
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 92.63
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 92.37
3dty_A 398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 92.3
3oqb_A 383 Oxidoreductase; structural genomics, protein struc 92.25
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 92.19
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 92.1
4gmf_A 372 Yersiniabactin biosynthetic protein YBTU; rossmann 91.99
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 91.79
2nu8_A 288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 91.76
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 91.07
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 90.93
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.89
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 90.71
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 90.44
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.42
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 90.38
2duw_A145 Putative COA-binding protein; ligand binding prote 90.37
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 90.31
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 90.26
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 90.25
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 90.24
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 90.12
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 90.11
1iuk_A140 Hypothetical protein TT1466; structural genomics, 90.05
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 90.02
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 89.82
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 89.51
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 89.38
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 89.35
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 89.33
1lss_A140 TRK system potassium uptake protein TRKA homolog; 89.33
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 89.29
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 89.14
2d59_A144 Hypothetical protein PH1109; COA binding, structur 89.14
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 89.11
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 89.1
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 89.09
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 89.08
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 89.06
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.79
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 88.55
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 88.54
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 88.47
1id1_A153 Putative potassium channel protein; RCK domain, E. 88.46
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 88.33
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 88.26
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 88.2
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 87.53
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 87.39
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 87.34
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 87.22
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 86.81
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 86.8
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 86.77
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 86.47
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 86.23
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.21
3c85_A183 Putative glutathione-regulated potassium-efflux S 86.1
1oi7_A 288 Succinyl-COA synthetase alpha chain; SCS, ligase, 86.09
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 85.63
1vpd_A 299 Tartronate semialdehyde reductase; structural geno 85.46
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 85.03
2rir_A300 Dipicolinate synthase, A chain; structural genomic 84.83
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 84.76
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 84.7
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 84.55
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 84.39
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 84.37
1yb4_A 295 Tartronic semialdehyde reductase; structural genom 84.09
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 84.05
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 83.96
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 83.72
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 83.54
4ezb_A 317 Uncharacterized conserved protein; structural geno 83.5
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 83.43
3eag_A 326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.29
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 83.15
1ygy_A 529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 82.75
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 82.62
3doj_A 310 AT3G25530, dehydrogenase-like protein; gamma-hydro 82.61
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 82.41
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 82.06
2h78_A 302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 81.88
3cky_A 301 2-hydroxymethyl glutarate dehydrogenase; rossmann 81.86
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 81.72
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 81.59
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 81.49
4dll_A 320 2-hydroxy-3-oxopropionate reductase; structural ge 81.33
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 81.28
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 81.13
3qha_A 296 Putative oxidoreductase; seattle structural genomi 80.88
4g65_A 461 TRK system potassium uptake protein TRKA; structur 80.66
4g65_A461 TRK system potassium uptake protein TRKA; structur 80.63
3l6d_A 306 Putative oxidoreductase; structural genomics, prot 80.52
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 80.39
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 80.37
4gbj_A 297 6-phosphogluconate dehydrogenase NAD-binding; stru 80.3
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
Probab=100.00  E-value=3e-64  Score=473.56  Aligned_cols=179  Identities=45%  Similarity=0.722  Sum_probs=172.2

Q ss_pred             ceeeEEEEcCChHHHHHHHHHHhCCCCCceEEEEcCCCCcccccccccccccccccCceEEEecCCeEEECCEEEEEEec
Q 024321           85 AKLKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSN  164 (269)
Q Consensus        85 ~~ikVaInGfGrIGR~llR~l~~r~~~~l~iVaInd~~~~~~~a~LlkyDS~hG~f~g~v~~~~~~~L~inGk~I~V~~~  164 (269)
                      |++||||||||||||+++|+++++  +++++|+|||..|+++++|||||||+||+|+++|++ ++++|.+||++|+|+++
T Consensus         3 m~~kv~INGfGrIGr~v~R~~~~~--~~~~ivaind~~d~~~~a~l~kyDS~hG~f~~~v~~-~~~~l~inGk~I~v~~e   79 (338)
T 3lvf_P            3 MAVKVAINGFGRIGRLAFRRIQEV--EGLEVVAVNDLTDDDMLAHLLKYDTMQGRFTGEVEV-VDGGFRVNGKEVKSFSE   79 (338)
T ss_dssp             CCEEEEEECCSHHHHHHHHHHHTS--TTEEEEEEECSSCHHHHHHHHHCCTTTCCCSSCEEE-ETTEEEETTEEEEEECC
T ss_pred             ccEEEEEECCCcHHHHHHHHHHHC--CCceEEEEecCCCHHHHHHHhccCCCCCCcCCeEEE-cCCEEEECCEEEEEEEe
Confidence            778999999999999999999986  469999999999999999999999999999999998 58899999999999999


Q ss_pred             CCCCCCCCCCCCccEEEEcCCCCCChhhHHHHHHcCCCEEEEecCCCCCCCCeEEeecCccccCCCCCceEEcCChhHHh
Q 024321          165 RDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNC  244 (269)
Q Consensus       165 ~~P~~i~w~~~gvDiVve~TG~f~~~e~a~~Hl~aGakkVIISAP~k~~Dip~iV~GVN~~~~~~~~~~IISnaSCTTn~  244 (269)
                      ++|+++||+++|+|||+||||.|+++|+++.|+++||||||||+|+++ |+||||||||++.|+++ ++|||||||||||
T Consensus        80 ~dp~~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViISaps~~-d~p~vV~gVN~~~~~~~-~~IISNasCTTn~  157 (338)
T 3lvf_P           80 PDASKLPWKDLNIDVVLECTGFYTDKDKAQAHIEAGAKKVLISAPATG-DLKTIVFNTNHQELDGS-ETVVSGASCTTNS  157 (338)
T ss_dssp             SCGGGSCTTTTTCSEEEECSSSCCBHHHHHHHHHTTCSEEEESSCCBS-SCEECCTTTTGGGCCSC-CSEEECCCHHHHH
T ss_pred             cccccCCccccCCCEEEEccCCcCCHHHHHHHHHcCCCEEEECCCCCC-CCCEEeccCCHHHcCcc-CCeEecCchhhhh
Confidence            999999999999999999999999999999999999999999999975 78999999999999876 8999999999999


Q ss_pred             HHHHHHHHhhhcCceEEEEee-ecc
Q 024321          245 LAPFVKVMDEELGKQSDLLND-HSV  268 (269)
Q Consensus       245 LaPvlkvL~d~fGI~~g~vTT-hsv  268 (269)
                      |+|++|+|||+|||++++||| ||+
T Consensus       158 Lap~lkvL~d~fGI~~g~mTTvha~  182 (338)
T 3lvf_P          158 LAPVAKVLNDDFGLVEGLMTTIHAY  182 (338)
T ss_dssp             HHHHHHHHHHHHCEEEEEEEEEEEC
T ss_pred             hHHHHHHHHHhcCEEEEEEeeeccc
Confidence            999999999999999999999 986



>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 269
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 4e-61
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 5e-59
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 5e-58
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 6e-57
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 4e-53
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 3e-51
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 2e-48
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 2e-47
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 8e-46
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 3e-44
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 6e-41
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 6e-38
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 7e-37
d1obfo2 162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 7e-06
d2g82a2 162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 5e-05
d3cmco2 163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 7e-05
d1rm4a2 163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 8e-05
d1u8fo2 164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 8e-05
d1k3ta2 169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 1e-04
d1lc0a1172 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase { 0.002
d1cf2o2 165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 0.003
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Spinach (Spinacia oleracea) [TaxId: 3562]
 Score =  188 bits (479), Expect = 4e-61
 Identities = 121/167 (72%), Positives = 137/167 (82%), Gaps = 2/167 (1%)

Query: 87  LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKI 146
           LKVAINGFGRIGRNFLRCWHGRKDSPLDVVV+ND+GGVK ASHLLKYDS+LGTF ADVK 
Sbjct: 1   LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKT 60

Query: 147 VDNETISVDGKLIKVVSNRDPLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVII 206
             +  ISVDGK+IKVVS+R+P+ LPW ++GID+VIEGTGVFVD  GAGKH+QAGAKKV+I
Sbjct: 61  AGDSAISVDGKVIKVVSDRNPVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLI 120

Query: 207 TAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNCLAPFVKVMD 253
           TAP KG DIPTYVVGVNE+ Y H    I+SNAS         V + D
Sbjct: 121 TAPGKG-DIPTYVVGVNEEGYTHA-DTIISNASNEWGYSQRVVDLAD 165


>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 172 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query269
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.66
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.65
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.33
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.23
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.15
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.08
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.08
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 98.99
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 97.77
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.63
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.09
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.08
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.96
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 96.73
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.62
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 96.17
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 96.1
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 95.75
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 95.65
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.46
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 94.86
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 94.51
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 94.44
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 94.3
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 94.22
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 93.94
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.63
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.59
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 93.14
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 92.9
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.66
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.62
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 92.34
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 92.17
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 91.55
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 91.4
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 91.33
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 91.14
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 91.09
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 90.6
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.56
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 90.16
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 89.76
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 89.73
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 89.56
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 89.15
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 89.12
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 89.09
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 89.01
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 87.79
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 87.78
d2gv8a1 335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 87.61
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 87.02
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 85.52
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 84.52
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 84.34
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 84.14
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 83.9
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 83.81
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 83.64
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 83.57
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 83.17
d2cvza2156 Hydroxyisobutyrate dehydrogenase {Thermus thermoph 82.4
d1id1a_153 Rck domain from putative potassium channel Kch {Es 82.05
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 81.79
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 81.45
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 81.09
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 80.87
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 80.55
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 80.5
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Spinach (Spinacia oleracea) [TaxId: 3562]
Probab=100.00  E-value=6.1e-61  Score=412.21  Aligned_cols=169  Identities=70%  Similarity=1.167  Sum_probs=159.4

Q ss_pred             eeEEEEcCChHHHHHHHHHHhCCCCCceEEEEcCCCCcccccccccccccccccCceEEEecCCeEEECCEEEEEEecCC
Q 024321           87 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVVNDSGGVKNASHLLKYDSLLGTFKADVKIVDNETISVDGKLIKVVSNRD  166 (269)
Q Consensus        87 ikVaInGfGrIGR~llR~l~~r~~~~l~iVaInd~~~~~~~a~LlkyDS~hG~f~g~v~~~~~~~L~inGk~I~V~~~~~  166 (269)
                      +||||||||||||+++|+++++...++++|+|||+.++++++|||+|||+||+|+++++.++++.+.+||+.|+++++++
T Consensus         1 ikIgINGfGRIGR~v~R~~~~~~~~~i~ivaINd~~~~~~~ayLlkyDSvhG~~~~~i~~~~~~~~~ing~~I~~~~~~~   80 (172)
T d1rm4a1           1 LKVAINGFGRIGRNFLRCWHGRKDSPLDVVVINDTGGVKQASHLLKYDSILGTFDADVKTAGDSAISVDGKVIKVVSDRN   80 (172)
T ss_dssp             EEEEEECCSHHHHHHHHHHHHCSSCSEEEEEEECTTCHHHHHHHHHCCTTTCSCSSCEEECTTSEEEETTEEEEEECCSC
T ss_pred             CEEEEECCCHHHHHHHHHHHhCCCCCEEEEEEcCCCCHHHHHHHHhcCcccccccceeEecCCcceEECCEEEEEecCCC
Confidence            58999999999999999999987777999999999999999999999999999999998765666789999999999999


Q ss_pred             CCCCCCCCCCccEEEEcCCCCCChhhHHHHHHcCCCEEEEecCCCCCCCCeEEeecCccccCCCCCceEEcCChhHHh--
Q 024321          167 PLQLPWAELGIDIVIEGTGVFVDGPGAGKHIQAGAKKVIITAPAKGADIPTYVVGVNEKDYDHEVANIVSNASCTTNC--  244 (269)
Q Consensus       167 P~~i~w~~~gvDiVve~TG~f~~~e~a~~Hl~aGakkVIISAP~k~~Dip~iV~GVN~~~~~~~~~~IISnaSCTTn~--  244 (269)
                      |+++||.++|+|+||||||.|.+++.++.||++||||||||||+++ |+|+||||||++.|+++ ++|||||||||||  
T Consensus        81 p~~i~W~~~gvDiViEcTG~f~~~~~~~~hl~~GakkViiSAP~k~-~~~tiV~GVN~~~~~~~-~~iIS~aSCTtn~~~  158 (172)
T d1rm4a1          81 PVNLPWGDMGIDLVIEGTGVFVDRDGAGKHLQAGAKKVLITAPGKG-DIPTYVVGVNEEGYTHA-DTIISNASNEWGYSQ  158 (172)
T ss_dssp             GGGSCHHHHTCCEEEECSSSCCBHHHHHHHHHTTCSCEEESSCCBS-SCCBCCTTTTGGGCCTT-CSEEECCCTTHHHHH
T ss_pred             hHHCChhhcCCCEEEecCceEccHHHHHHHHhcCCceEEeeccccc-ceeeEEeecchhhcCCC-CCEEEcccchhccHh
Confidence            9999999999999999999999999999999999999999999987 68999999999999987 8999999999555  


Q ss_pred             -HHHHHHHHhhhcC
Q 024321          245 -LAPFVKVMDEELG  257 (269)
Q Consensus       245 -LaPvlkvL~d~fG  257 (269)
                       |+|++|+||++|.
T Consensus       159 ~l~pv~~vi~~~f~  172 (172)
T d1rm4a1         159 RVVDLADIVANKWQ  172 (172)
T ss_dssp             HHHHHHHHHHHTCC
T ss_pred             HhHHHHHHHHhhcC
Confidence             9999999999984



>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cvza2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure