Query         024346
Match_columns 269
No_of_seqs    143 out of 291
Neff          6.1 
Searched_HMMs 29240
Date          Mon Mar 25 06:39:58 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/024346.a3m -d /work/01045/syshi/HHdatabase/pdb70.hhm -o /work/01045/syshi/hhsearch_pdb/024346hhsearch_pdb -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1nrp_R Receptor based peptide   22.9      15  0.0005   20.8  -0.4   10  111-120     9-19  (26)
  2 1nro_R Receptor based peptide   22.3      17 0.00057   20.7  -0.2   10  111-120     9-19  (27)
  3 2xvc_A ESCRT-III, SSO0910; cel  17.0      37  0.0013   23.4   0.6   25   71-95     23-47  (59)
  4 1wi9_A Protein C20ORF116 homol  12.1      93  0.0032   22.3   1.6   27   72-98     20-46  (72)
  5 4grv_A Neurotensin receptor ty  12.1   8E+02   0.027   22.3  10.5   32  109-140    23-56  (510)
  6 2wsc_H Photosystem I reaction   11.4      63  0.0022   25.9   0.5   11  107-117    64-74  (144)
  7 3ech_C 25-MER fragment of prot   9.6      37  0.0013   19.1  -1.0    6  112-117    16-21  (25)
  8 2kih_A Matrix protein 2; S31N,   9.2 2.7E+02  0.0092   17.6   2.8   17  251-267    15-31  (43)
  9 3tdu_C Cullin-1, CUL-1; E2:E3,   7.6      66  0.0023   23.0  -0.7   35   79-116    39-73  (77)
 10 2knc_A Integrin alpha-IIB; tra   6.8 4.1E+02   0.014   17.7   3.1   15  255-269    26-40  (54)

No 1  
>1nrp_R Receptor based peptide NR'S; serine proteinase/receptor; 3.00A {Homo sapiens} PDB: 1nrn_R 1nrq_R*
Probab=22.93  E-value=15  Score=20.83  Aligned_cols=10  Identities=50%  Similarity=1.109  Sum_probs=7.6

Q ss_pred             CCC-CchHHHH
Q 024346          111 ANP-DLYGLIW  120 (269)
Q Consensus       111 ~~p-DLYGP~W  120 (269)
                      +|| |-|-|||
T Consensus         9 rnpndkyepfw   19 (26)
T 1nrp_R            9 RNPNDKYEPFW   19 (26)
T ss_pred             cCCCcccCccc
Confidence            344 8899999


No 2  
>1nro_R Receptor based peptide NRP; serine proteinase/receptor; 3.10A {Homo sapiens}
Probab=22.25  E-value=17  Score=20.74  Aligned_cols=10  Identities=50%  Similarity=1.109  Sum_probs=7.7

Q ss_pred             CCC-CchHHHH
Q 024346          111 ANP-DLYGLIW  120 (269)
Q Consensus       111 ~~p-DLYGP~W  120 (269)
                      +|| |-|-|||
T Consensus         9 rnpndkyepfw   19 (27)
T 1nro_R            9 RNPNDKYEPFW   19 (27)
T ss_pred             cCCCcccCccc
Confidence            344 8899999


No 3  
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus}
Probab=16.96  E-value=37  Score=23.42  Aligned_cols=25  Identities=24%  Similarity=0.549  Sum_probs=21.9

Q ss_pred             cceeeeecccccccCChHHHHHHhh
Q 024346           71 KGFFSISSYTQYFNVDTDIVINRLF   95 (269)
Q Consensus        71 ~~~~si~yY~~yFdVDT~~V~~Rl~   95 (269)
                      .|+..+++....|.|+-++|++=|+
T Consensus        23 GGildI~~~a~kygV~kdeV~~~Lr   47 (59)
T 2xvc_A           23 GGFLDIEHFSKVYGVEKQEVVKLLE   47 (59)
T ss_dssp             TSEEEHHHHHHHHCCCHHHHHHHHH
T ss_pred             CCEEeHHHHHHHhCCCHHHHHHHHH
Confidence            5899999999999999999986554


No 4  
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47
Probab=12.13  E-value=93  Score=22.26  Aligned_cols=27  Identities=19%  Similarity=0.188  Sum_probs=22.5

Q ss_pred             ceeeeecccccccCChHHHHHHhhhcc
Q 024346           72 GFFSISSYTQYFNVDTDIVINRLFSSL   98 (269)
Q Consensus        72 ~~~si~yY~~yFdVDT~~V~~Rl~~sl   98 (269)
                      ....++-...=|++.|+++.+||..-.
T Consensus        20 Kvv~LedLA~~F~l~t~~~i~RI~~Le   46 (72)
T 1wi9_A           20 KVVLLEDLAFQMGLRTQDAINRIQDLL   46 (72)
T ss_dssp             SEECHHHHHHHHCSCHHHHHHHHHHHH
T ss_pred             CeeeHHHHHHHhCCChHHHHHHHHHHH
Confidence            456777888889999999999998643


No 5  
>4grv_A Neurotensin receptor type 1, lysozyme chimera; G-protein coupled receptor, G-protein, signaling protein-agonist complex; HET: EPE; 2.80A {Rattus norvegicus}
Probab=12.12  E-value=8e+02  Score=22.25  Aligned_cols=32  Identities=25%  Similarity=0.615  Sum_probs=22.7

Q ss_pred             cCCCCCchHHHHHHH--HHHHHHHHhhhHHHHHh
Q 024346          109 IDANPDLYGLIWIST--TLVFMLASFGNCATYLM  140 (269)
Q Consensus       109 ~~~~pDLYGP~WI~~--TLif~l~i~~nl~~~l~  140 (269)
                      .+.+.|+|.-+.+++  .+|+++++.||+.-.+.
T Consensus        23 ~~~~~~~~~~v~~~~~~~~i~~~g~~gN~lvi~~   56 (510)
T 4grv_A           23 LDVNTDIYSKVLVTAIYLALFVVGTVGNSVTLFT   56 (510)
T ss_dssp             CCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCcChhHHHHHHHHHHHHHHHHHHHHHHHHhhhh
Confidence            355789999887765  56777788898655443


No 6  
>2wsc_H Photosystem I reaction center subunit VI, chloroplastic; photosynthesis, electron transfer, membrane proteins, large complexes; HET: CL1 PQN BCR LMU LMG SUC UNL; 3.30A {Spinacia oleracea} PDB: 2wse_H* 2wsf_H* 2o01_H* 3lw5_H*
Probab=11.38  E-value=63  Score=25.88  Aligned_cols=11  Identities=27%  Similarity=0.558  Sum_probs=8.6

Q ss_pred             cccCCCCCchH
Q 024346          107 SKIDANPDLYG  117 (269)
Q Consensus       107 ~~~~~~pDLYG  117 (269)
                      ++.-++|||||
T Consensus        64 ~nTTG~WDlYG   74 (144)
T 2wsc_H           64 ANTTGQWDVYG   74 (144)
T ss_dssp             CCSSCTTSSCC
T ss_pred             ccccccceecc
Confidence            34567899999


No 7  
>3ech_C 25-MER fragment of protein ARMR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa}
Probab=9.63  E-value=37  Score=19.05  Aligned_cols=6  Identities=67%  Similarity=0.988  Sum_probs=4.9

Q ss_pred             CCCchH
Q 024346          112 NPDLYG  117 (269)
Q Consensus       112 ~pDLYG  117 (269)
                      .|||||
T Consensus        16 awdly~   21 (25)
T 3ech_C           16 AWDLYG   21 (26)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            589987


No 8  
>2kih_A Matrix protein 2; S31N, proton channel, cell membrane, disulfide bond, hydrogen ION transport, ION transport, ionic channel, membrane; NMR {Influenza a virus} PDB: 2rlf_A* 2l0j_A 2kwx_A
Probab=9.17  E-value=2.7e+02  Score=17.61  Aligned_cols=17  Identities=24%  Similarity=0.315  Sum_probs=13.5

Q ss_pred             HHHHHHHHHHHHHHHhc
Q 024346          251 ASFCLQMALAIFIKVWF  267 (269)
Q Consensus       251 ~i~~lh~~lal~~K~~F  267 (269)
                      .+..+|+.+.+.=+++|
T Consensus        15 iiGIlHLiLwildRlff   31 (43)
T 2kih_A           15 IIGILHLILWILDRLFF   31 (43)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            45779999998877765


No 9  
>3tdu_C Cullin-1, CUL-1; E2:E3, ligase-protein binding complex; 1.50A {Homo sapiens} PDB: 3tdz_C
Probab=7.63  E-value=66  Score=23.05  Aligned_cols=35  Identities=11%  Similarity=0.350  Sum_probs=23.7

Q ss_pred             ccccccCChHHHHHHhhhccccCCCccccccCCCCCch
Q 024346           79 YTQYFNVDTDIVINRLFSSLHPLSGDFFSKIDANPDLY  116 (269)
Q Consensus        79 Y~~yFdVDT~~V~~Rl~~sl~P~~~~f~~~~~~~pDLY  116 (269)
                      .+.-|..+..++++||-.-+-   .++.++..++||.|
T Consensus        39 l~~rF~p~~~~IKk~IE~LIe---reYl~R~~~~~~~y   73 (77)
T 3tdu_C           39 LSSRFKPRVPVIKKCIDILIE---KEYLERVDGEKDTY   73 (77)
T ss_dssp             HTTTCCCCHHHHHHHHHHHHH---TTSEEEETTEEEEE
T ss_pred             HhCcCCCCHHHHHHHHHHHHh---hhHhhcCCCCCceE
Confidence            456688999998888764332   34666666677776


No 10 
>2knc_A Integrin alpha-IIB; transmembrane signaling, protein structure, cell A cleavage on PAIR of basic residues, disease mutation, disul bond, glycoprotein; NMR {Homo sapiens}
Probab=6.81  E-value=4.1e+02  Score=17.74  Aligned_cols=15  Identities=33%  Similarity=0.465  Sum_probs=9.3

Q ss_pred             HHHHHHHHHHHhcCC
Q 024346          255 LQMALAIFIKVWFFP  269 (269)
Q Consensus       255 lh~~lal~~K~~FF~  269 (269)
                      +=+...++.|.-||+
T Consensus        26 L~li~~~LwK~GFFk   40 (54)
T 2knc_A           26 LTILVLAMWKVGFFK   40 (54)
T ss_dssp             HHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHcCccc
Confidence            444455666777874


Done!