Citrus Sinensis ID: 024347


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MSQPKIKRRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKLVKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLLLDAYGNLKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLNDRGYDGSTADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEFTCPPWLSFTARKLIARILDPNPMTVSIYPFADILYMRF
ccccccccccccEEEEEEEEcccccEEEEEEEcccccEEEEEEEEHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEEEEcccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEECccccccccccccccCECcccccccccccHHccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccHcccccccccc
***********KYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKLVKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLLLDAYGNLKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLNDRGYDGSTADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEFTCPPWLSFTARKLIARILDPNPMTVSIYPFADILYMRF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSQPKIKRRVGKYEVGRTIGEGTFAKVKFARNSETGEPVALKILDKEKVLKHKMAEQIKREVATMKLVKHPNVVRLYEVMGSKTKIFIVLEFVTGGELFDKIVNHGRMKEDEARRYFQQLINAVDYCHSRGVYHRDLKPENLLLDAYGNLKVSDFGLSALSQQVRDDGLLHTTCGTPNYVAPEVLNDRGYDGSTADLWSCGVILFVLLAGYLPFDDSNLMNLYKKISAAEFTCPPWLSFTARKLIARILDPNPMTVSIYPFADILYMRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
CBL-interacting serine/threonine-protein kinase 3 Involved in the resistance to some abiotic stresses (e.g. high salt, hyperosmotic stress) in young seedlings, by regulating the expression of several stress-inducible genes (cold-and salt-induced genes but not drought-responsive genes). Required for the ABA response during germination. CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ2V452
CBL-interacting protein kinase 32 CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ2QY53
CBL-interacting protein kinase 33 CIPK serine-threonine protein kinases interact with CBL proteins. Binding of a CBL protein to the regulatory NAF domain of CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ2RAX3

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H6D, chain A
Confidence level:very confident
Coverage over the Query: 7-163,180-269
View the alignment between query and template
View the model in PyMOL