Citrus Sinensis ID: 024376

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGGTRAATAG
ccccccccccHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccEEccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccEEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEcEEEccccccccccccccccccccccEEEcccccccccccccccccccEcccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccEcccc
mddgevdfsnqEMLSanigdfpscsmdsfFEDILkdthacththtcnppgpdsshthtcfhvhtkivaptsedkvstddtaestekktkkrplgnrEAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGriegeigsfpyqksvnnmnlpnphsagayvvnpcnmrcddqvyclhpgmedksgegielngqgfsgcefenlqcvgnqssgvrelpgcgdgnvatnthssatknrkggtraatag
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTkivaptsedkvstddtaestekktkkrplgnreavrkyrekkkartasledevvRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNvatnthssatknrkggtraatag
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGGTRAATAG
*****************IGDFPSCSMDSFFEDILKDTHACTHTHTC*********THTCFHVHTKIV*************************************************VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGM******GIELNGQGFSGCEFENLQCVG***************************************
****EVDFSNQEM***************FFEDILKDTHACTH******************************************************************RTASLED*VV*****************ALEAEVARLKCLLV*************************************CNMRCDDQVYC***********************************************************************
********SNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPT************************NREAVR************LEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHS****************
***********EMLSAN*G*FPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAP*************************NREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGD*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDGEVDFSNQEMLSANIGDFPSCSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARxxxxxxxxxxxxxxxxxxxxxLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVRELPGCGDGNVATNTHSSATKNRKGGTRAATAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query268 2.2.26 [Sep-21-2011]
Q41558 476 Transcription factor HBP- N/A no 0.380 0.214 0.333 0.0003
>sp|Q41558|HBP1C_WHEAT Transcription factor HBP-1b(c1) (Fragment) OS=Triticum aestivum PE=1 SV=2 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 56/108 (51%), Gaps = 6/108 (5%)

Query: 27  DSFFEDILKDTHACTHTHTCNPPGPDSSHTHTCFHVHTKIVAPTSEDKVSTDDTAESTEK 86
           D++ E  + DT   T T T   P  D    +  F    ++ APT+ D  S+D + +  + 
Sbjct: 136 DNWGESSMADTSPRTDTST--DPDIDIDERNQMFE-QGQLAAPTASD--SSDKSRDKLDH 190

Query: 87  KTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLK-RLQG 133
           K+ +R   NREA RK R +KKA   +LE   ++L  + Q+L + R QG
Sbjct: 191 KSLRRLAQNREAARKSRLRKKAYIQNLESSRLKLTQLEQELQRARQQG 238
Transcriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. Binds to the hexamer motif 5'-ACGTCA-3' of histone gene promoters.
Triticum aestivum (taxid: 4565)

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
255587127284 DNA binding protein, putative [Ricinus c 0.985 0.929 0.755 1e-118
398806220270 bZIP transcription factor family protein 0.981 0.974 0.752 1e-114
225428029273 PREDICTED: uncharacterized protein LOC10 0.970 0.952 0.740 1e-112
147768431264 hypothetical protein VITISV_026643 [Viti 0.962 0.977 0.742 1e-111
449454205270 PREDICTED: uncharacterized protein LOC10 0.988 0.981 0.739 1e-105
224078323265 predicted protein [Populus trichocarpa] 0.962 0.973 0.725 1e-105
449458616273 PREDICTED: uncharacterized protein LOC10 0.970 0.952 0.703 1e-105
449515738262 PREDICTED: uncharacterized protein LOC10 0.958 0.980 0.755 1e-104
224105159264 predicted protein [Populus trichocarpa] 0.966 0.981 0.712 1e-104
398806218270 bZIP transcription factor family protein 0.981 0.974 0.693 1e-102
>gi|255587127|ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis] gi|223525783|gb|EEF28231.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 204/270 (75%), Positives = 238/270 (88%), Gaps = 6/270 (2%)

Query: 1   MDDGEVDFSNQEMLSA-NIGDFPS-CSMDSFFEDILKDTHACTHTHTCNPPGPDSSHTHT 58
           MDDGE+DFS+QE+ S  N+G+ P+ CSMDSFF+++LKDTHACTHTHTCNPPGPD SHTHT
Sbjct: 1   MDDGELDFSHQEVFSGTNMGEMPNNCSMDSFFDELLKDTHACTHTHTCNPPGPDYSHTHT 60

Query: 59  CFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVV 118
           CFHVHTKIV+  S+DK  TDDTAESTEKK+KKRPLGNREAVRKYREKKKAR ASLEDEVV
Sbjct: 61  CFHVHTKIVSAPSDDKTGTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDEVV 120

Query: 119 RLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNPHS 178
           +LRA+NQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKS N++N PNP+ 
Sbjct: 121 KLRALNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSANDVNFPNPNY 180

Query: 179 AGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVREL 238
           +GAYV+NPCNM+C+DQVYCLHPG++ +S +GI LNGQGF+GC+F+NLQC+ NQ+S  +EL
Sbjct: 181 SGAYVMNPCNMQCNDQVYCLHPGVDGRSDDGIALNGQGFNGCDFDNLQCLANQNSAAKEL 240

Query: 239 PGCGDGNVATNT----HSSATKNRKGGTRA 264
           P CG GNV TN     +SS+T  RKG T +
Sbjct: 241 PSCGLGNVLTNDNGNGNSSSTNKRKGKTSS 270

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|398806220|gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis] Back     alignment and taxonomy information
>gi|225428029|ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera] Back     alignment and taxonomy information
>gi|147768431|emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera] Back     alignment and taxonomy information
>gi|449454205|ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224078323|ref|XP_002305521.1| predicted protein [Populus trichocarpa] gi|222848485|gb|EEE86032.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449458616|ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus] gi|449489648|ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449515738|ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224105159|ref|XP_002313707.1| predicted protein [Populus trichocarpa] gi|222850115|gb|EEE87662.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|398806218|gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query268
TAIR|locus:2131626261 bZIP19 "AT4G35040" [Arabidopsi 0.955 0.980 0.619 3.8e-85
TAIR|locus:2059851249 bZIP23 "AT2G16770" [Arabidopsi 0.917 0.987 0.628 1.7e-84
TAIR|locus:2083760228 BZIP24 "AT3G51960" [Arabidopsi 0.570 0.671 0.496 5.7e-36
UNIPROTKB|F1NAC0262 XBP1 "Uncharacterized protein" 0.238 0.244 0.426 0.0005
TAIR|locus:2131626 bZIP19 "AT4G35040" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 852 (305.0 bits), Expect = 3.8e-85, P = 3.8e-85
 Identities = 168/271 (61%), Positives = 213/271 (78%)

Query:     1 MDDGEVDFSNQEMLSAN-IGDFP--SCSMDSFFEDILKDTHA-CTHTHTCNPPGPDSSHT 56
             M+DGE+DFSNQE+ S++ +G+ P  +CSMDSFF+ +L DT+A CTHTHTCNP GP+++HT
Sbjct:     1 MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT 60

Query:    57 HTCFHVHTKIVAPTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE 116
             HTCFHVHTKI+   S++KVSTDDTAES  KK +KRPLGNREAVRKYREKKKA+ ASLEDE
Sbjct:    61 HTCFHVHTKILPDESDEKVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLEDE 120

Query:   117 VVRLRAVNQQLLKRLQGQAALEAEVARLKCLLVDIRGRIEGEIGSFPYQKSVNNMNLPNP 176
             V RLRAVNQQL+KRLQ QA LEAEV+RLKCLLVD+RGRI+GEIGSFPYQK +   N+P+ 
Sbjct:   121 VARLRAVNQQLVKRLQNQATLEAEVSRLKCLLVDLRGRIDGEIGSFPYQKPMA-ANIPS- 178

Query:   177 HSAGAYVVNPCNMRCDDQVYCLHPGMEDKSGEGIELNGQGFSGCEFENLQCVGNQSSGVR 236
                 ++++NPCN++CDD+VYC        S EG  +N QG SGC+F+ LQC+ NQ+    
Sbjct:   179 ---FSHMMNPCNVQCDDEVYCPQNVFGVNSQEGASINDQGLSGCDFDQLQCMANQN---- 231

Query:   237 ELPGCGDGNVATNTHSSATKNRKGGTRAATA 267
              L G G+G+ + N ++S +  RKGG RA+ A
Sbjct:   232 -LNGNGNGSFS-NVNTSVSNKRKGGHRASRA 260
GO:0003677 "DNA binding" evidence=ISS;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA;ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0046983 "protein dimerization activity" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0010043 "response to zinc ion" evidence=IEP
GO:0071294 "cellular response to zinc ion" evidence=IGI
GO:0009410 "response to xenobiotic stimulus" evidence=RCA
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=RCA
TAIR|locus:2059851 bZIP23 "AT2G16770" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083760 BZIP24 "AT3G51960" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|F1NAC0 XBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00036120001
SubName- Full=Putative uncharacterized protein (Chromosome chr3 scaffold_8, whole genome shotgun sequence); (264 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
smart0033865 smart00338, BRLZ, basic region leucin zipper 4e-14
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 2e-12
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 3e-08
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 65.3 bits (160), Expect = 4e-14
 Identities = 27/67 (40%), Positives = 40/67 (59%), Gaps = 4/67 (5%)

Query: 82  ESTEKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEV 141
           E  EK+ ++R   NREA R+ RE+KKA    LE +V +L A N++L K ++    L  E+
Sbjct: 1   EEDEKRRRRR-ERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIE---RLRREL 56

Query: 142 ARLKCLL 148
            +LK  L
Sbjct: 57  EKLKSEL 63

Length = 65
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 268
smart0033865 BRLZ basic region leucin zipper. 99.49
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.37
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.16
KOG0837279 consensus Transcriptional activator of the JUN fam 98.81
KOG4005292 consensus Transcription factor XBP-1 [Transcriptio 98.68
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 98.64
KOG4571294 consensus Activating transcription factor 4 [Trans 98.63
KOG3584348 consensus cAMP response element binding protein an 98.61
KOG0709472 consensus CREB/ATF family transcription factor [Tr 98.44
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 97.93
KOG3119269 consensus Basic region leucine zipper transcriptio 97.52
KOG3863604 consensus bZIP transcription factor NRF1 [Transcri 97.06
KOG4196135 consensus bZIP transcription factor MafK [Transcri 96.85
TIGR0244965 conserved hypothetical protein TIGR02449. Members 96.36
PRK13922276 rod shape-determining protein MreC; Provisional 95.1
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.65
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 94.39
TIGR00219283 mreC rod shape-determining protein MreC. MreC (mur 94.23
PRK13169110 DNA replication intiation control protein YabA; Re 92.91
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 92.53
PRK0029568 hypothetical protein; Provisional 92.17
PRK10884206 SH3 domain-containing protein; Provisional 91.92
PRK10884206 SH3 domain-containing protein; Provisional 91.73
PRK0432574 hypothetical protein; Provisional 91.6
PF0882661 DMPK_coil: DMPK coiled coil domain like; InterPro: 91.35
PRK0440675 hypothetical protein; Provisional 91.33
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 91.31
PRK0279372 phi X174 lysis protein; Provisional 91.28
PRK0211973 hypothetical protein; Provisional 90.85
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 90.65
PRK1542279 septal ring assembly protein ZapB; Provisional 90.58
PHA03155115 hypothetical protein; Provisional 90.55
PRK13729 475 conjugal transfer pilus assembly protein TraB; Pro 90.54
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 90.48
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 90.37
PF04880166 NUDE_C: NUDE protein, C-terminal conserved region; 90.32
PRK0073668 hypothetical protein; Provisional 90.27
COG307479 Uncharacterized protein conserved in bacteria [Fun 89.82
PHA03162135 hypothetical protein; Provisional 89.76
PRK00888105 ftsB cell division protein FtsB; Reviewed 89.75
COG1792284 MreC Cell shape-determining protein [Cell envelope 89.7
PF05812118 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: 89.63
KOG3119269 consensus Basic region leucine zipper transcriptio 88.63
PRK13169110 DNA replication intiation control protein YabA; Re 88.3
PRK0084677 hypothetical protein; Provisional 87.82
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 87.77
COG4467114 Regulator of replication initiation timing [Replic 87.67
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 87.64
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 87.52
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.98
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 86.89
PF0472856 LPP: Lipoprotein leucine-zipper; InterPro: IPR0068 86.28
COG2433652 Uncharacterized conserved protein [Function unknow 86.17
KOG4343 655 consensus bZIP transcription factor ATF6 [Transcri 85.8
PF10805106 DUF2730: Protein of unknown function (DUF2730); In 85.42
KOG1318411 consensus Helix loop helix transcription factor EB 84.86
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.73
KOG0977 546 consensus Nuclear envelope protein lamin, intermed 84.56
PRK14872 337 rod shape-determining protein MreC; Provisional 84.49
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 84.21
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 84.19
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 83.94
PRK00888105 ftsB cell division protein FtsB; Reviewed 83.77
COG4026290 Uncharacterized protein containing TOPRIM domain, 83.76
COG4942 420 Membrane-bound metallopeptidase [Cell division and 83.43
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 82.64
KOG1414395 consensus Transcriptional activator FOSB/c-Fos and 82.64
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 82.32
PF1374789 DUF4164: Domain of unknown function (DUF4164) 82.3
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 82.16
KOG4797123 consensus Transcriptional regulator [Transcription 81.66
PRK11637 428 AmiB activator; Provisional 81.5
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 81.28
PF1419769 Cep57_CLD_2: Centrosome localisation domain of PPC 80.98
PRK09039343 hypothetical protein; Validated 80.95
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 80.77
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 80.44
>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information 
Probab=99.49  E-value=1e-13  Score=101.23  Aligned_cols=62  Identities=40%  Similarity=0.548  Sum_probs=57.1

Q ss_pred             HHHhhccCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024376           85 EKKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLKCLLV  149 (268)
Q Consensus        85 d~KK~KRmlSNRESARRSR~RKQahleeLE~QV~qLraeN~qL~~rL~~~a~LEaEn~~LRaqL~  149 (268)
                      ++|+.||+++||+||++||+||++++.+||.+|..|..+|..|..++   ..|+.|+..|+.++.
T Consensus         3 ~~k~~rR~~rNR~aA~~~R~rKk~~~~~Le~~~~~L~~en~~L~~~~---~~l~~e~~~lk~~~~   64 (65)
T smart00338        3 DEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEI---ERLRRELEKLKSELE   64 (65)
T ss_pred             cHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHhc
Confidence            56899999999999999999999999999999999999999999987   568899999988764

>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>KOG0837 consensus Transcriptional activator of the JUN family [Transcription] Back     alignment and domain information
>KOG4005 consensus Transcription factor XBP-1 [Transcription] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>KOG4571 consensus Activating transcription factor 4 [Transcription] Back     alignment and domain information
>KOG3584 consensus cAMP response element binding protein and related transcription factors [Transcription] Back     alignment and domain information
>KOG0709 consensus CREB/ATF family transcription factor [Transcription] Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>KOG3863 consensus bZIP transcription factor NRF1 [Transcription] Back     alignment and domain information
>KOG4196 consensus bZIP transcription factor MafK [Transcription] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>TIGR00219 mreC rod shape-determining protein MreC Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PF08826 DMPK_coil: DMPK coiled coil domain like; InterPro: IPR014930 This domain is found in the myotonic dystrophy protein kinase (DMPK) and adopts a coiled coil structure Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PHA03155 hypothetical protein; Provisional Back     alignment and domain information
>PRK13729 conjugal transfer pilus assembly protein TraB; Provisional Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF04880 NUDE_C: NUDE protein, C-terminal conserved region; InterPro: IPR006964 This domain represents the C-terminal conserved region of NUDE proteins Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PHA03162 hypothetical protein; Provisional Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>COG1792 MreC Cell shape-determining protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF05812 Herpes_BLRF2: Herpesvirus BLRF2 protein; InterPro: IPR008642 This family consists of several herpes virus BLRF2 tegument proteins Back     alignment and domain information
>KOG3119 consensus Basic region leucine zipper transcription factor [Transcription] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF04728 LPP: Lipoprotein leucine-zipper; InterPro: IPR006817 This repeating sequence, NAKVDQLSNDV, is found in the enterobacterial outer membrane lipoprotein LPP Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4343 consensus bZIP transcription factor ATF6 [Transcription] Back     alignment and domain information
>PF10805 DUF2730: Protein of unknown function (DUF2730); InterPro: IPR020269 This entry represents a family of various hypothetical proteins Back     alignment and domain information
>KOG1318 consensus Helix loop helix transcription factor EB [Transcription] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>KOG0977 consensus Nuclear envelope protein lamin, intermediate filament superfamily [Cell cycle control, cell division, chromosome partitioning; Nuclear structure] Back     alignment and domain information
>PRK14872 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG1414 consensus Transcriptional activator FOSB/c-Fos and related bZIP transcription factors [Transcription] Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF13747 DUF4164: Domain of unknown function (DUF4164) Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>KOG4797 consensus Transcriptional regulator [Transcription] Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF14197 Cep57_CLD_2: Centrosome localisation domain of PPC89 Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query268
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-13
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 2e-11
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 2e-11
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 6e-10
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 1e-09
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 4e-09
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 1e-08
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 1e-08
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 7e-08
2wt7_B90 Transcription factor MAFB; transcription, transcri 6e-07
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
 Score = 62.8 bits (153), Expect = 2e-13
 Identities = 22/66 (33%), Positives = 34/66 (51%), Gaps = 4/66 (6%)

Query: 86  KKTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQGQAALEAEVARLK 145
           KK KK    N+ A  +YR+KK+A   +L  E   L   N+ L +R     +L  E+  LK
Sbjct: 2   KKLKKM-EQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERAD---SLAKEIQYLK 57

Query: 146 CLLVDI 151
            L+ ++
Sbjct: 58  DLIEEV 63
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Length = 70 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Length = 78 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.52
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.48
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.41
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.41
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.38
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.37
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 99.08
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 99.08
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.96
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 98.36
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.19
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 97.06
3m48_A33 General control protein GCN4; leucine zipper, synt 96.3
1deb_A54 APC protein, adenomatous polyposis coli protein; c 96.03
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 96.03
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 95.91
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 95.83
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 95.68
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 95.6
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 95.59
1uo4_A34 General control protein GCN4; four helix bundle, c 95.36
2bni_A34 General control protein GCN4; four helix bundle, a 95.1
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 95.03
2hy6_A34 General control protein GCN4; protein design, para 95.01
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.87
2j5u_A255 MREC protein; bacterial cell shape determining pro 93.55
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 92.47
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 92.43
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 91.87
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 91.84
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 91.27
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 91.05
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 90.33
2oa5_A110 Hypothetical protein BQLF2; MHR28B, NESG, structur 89.28
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 88.95
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 88.54
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 88.52
2xv5_A74 Lamin-A/C; structural protein, intermediate filame 88.16
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 87.48
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 86.88
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 86.76
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.51
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 84.93
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 84.65
1fmh_A33 General control protein GCN4; coiled coil, leucine 84.19
1wt6_A81 Myotonin-protein kinase; coiled-coil, kinase activ 84.07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 83.56
3m9b_A251 Proteasome-associated ATPase; coil COIL with 5 bet 82.92
1gk6_A59 Vimentin; intermediate filament, dimer, parallel c 81.08
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.52  E-value=7.7e-15  Score=105.44  Aligned_cols=46  Identities=41%  Similarity=0.533  Sum_probs=42.4

Q ss_pred             HhhccCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 024376           87 KTKKRPLGNREAVRKYREKKKARTASLEDEVVRLRAVNQQLLKRLQ  132 (268)
Q Consensus        87 KK~KRmlSNRESARRSR~RKQahleeLE~QV~qLraeN~qL~~rL~  132 (268)
                      |+++||++|||||++||+|||+|+++||.+|.+|+.+|..|..++.
T Consensus         1 kr~rR~~~NResA~rSR~RKk~~~~~LE~~v~~L~~eN~~L~~~~~   46 (55)
T 1dh3_A            1 KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELK   46 (55)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ChHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            5789999999999999999999999999999999999988877653
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1deb_A APC protein, adenomatous polyposis coli protein; coiled coil, tumor suppressor, structural protein; 2.40A {Homo sapiens} SCOP: h.1.18.1 Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2j5u_A MREC protein; bacterial cell shape determining protein MREC, cell shape regulation; 2.5A {Listeria monocytogenes} Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>2oa5_A Hypothetical protein BQLF2; MHR28B, NESG, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; HET: PE5; 2.10A {Murid herpesvirus 4} SCOP: d.362.1.1 PDB: 2h3r_A* Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>2xv5_A Lamin-A/C; structural protein, intermediate filaments, nuclear membrane LEFT-handed coiled coil, right-handed coiled coil; HET: MSE; 2.40A {Homo sapiens} Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>1wt6_A Myotonin-protein kinase; coiled-coil, kinase activation, DMPK, molecular replacement, transferase; 1.60A {Homo sapiens} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>1gk6_A Vimentin; intermediate filament, dimer, parallel coiled coil, heptad repeat, leucine zipper, fusion protein; 1.9A {Saccharomyces cerevisiae} SCOP: h.1.20.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query268
d2oa5a196 Uncharacterized protein BQLF2 {Murid herpesvirus 4 89.32
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 86.87
>d2oa5a1 d.362.1.1 (A:7-102) Uncharacterized protein BQLF2 {Murid herpesvirus 4 [TaxId: 33708]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: BLRF2-like
superfamily: BLRF2-like
family: BLRF2-like
domain: Uncharacterized protein BQLF2
species: Murid herpesvirus 4 [TaxId: 33708]

Probab=89.32  E-value=0.41  Score=36.26  Aligned_cols=50  Identities=16%  Similarity=0.312  Sum_probs=35.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH----------------HHHHHHHHHHHHHHHHH-HHhhhhhhc
Q 024376          110 TASLEDEVVRLRAVNQQLLKRLQG----------------QAALEAEVARLKCLLVD-IRGRIEGEI  159 (268)
Q Consensus       110 leeLE~QV~qLraeN~qL~~rL~~----------------~a~LEaEn~~LRaqL~e-lr~rl~~~i  159 (268)
                      +++|.+++.+|+-||..|.++|..                .+.+-+-+.+|-++.+. |+.||....
T Consensus         4 ~EeLaaeL~rL~~ENk~LKkkl~~~~~~~~~d~~LT~~qke~~I~s~~~~lts~A~kKIe~kV~~~~   70 (96)
T d2oa5a1           4 YEEMVKEVERLKLENKTLKQKVKSSGAVSSDDSILTAAKRESIIVSSSRALGAVAMRKIEAKVRSRA   70 (96)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTC---------CCBCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            689999999999999999999963                33444555666555444 566666443
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure