Citrus Sinensis ID: 024396

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27
MVKASVSSGHKTFVYARPVTQNSRPSKLEIHKEFQGIGVTIIEGELDEHKKIVSILKEVDVVISTVAYPQFLDQLEIVHAIKVAGNIKRFLPSEFGCEEDKVRPLPPFEAYLEKKRIVRRAIEAAQIPYTFVSANLCGAYFVNVLLRPFESHDDVVVYGSGEAKVVFNYEEDIAKCTIKEQKIGQSFKRIQVSEEELVKLSHTLPPPEDIPISIMHSLLAKGDSMNFELGEDDIEASKLYPDFKFTTIDQLLDIFLIDPPKPARTAFE
ccccHHHccccEEEEEccccccccccHHHHHHHHHcccEEEEEEccccHHHHHHHHccccEEEEcccccccccHHHHHHHHHHccccCEECccccccccccccccccHHHHHHHHHHHHHHHHHccccEEEccccccHHHcccccccccccccEEEEEcccccEEEEccHHHHHHHHHHHHHHcccccEEcccHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHcccccccccccHHHHHHHHccccccccccccc
MVKASVSSGHKTFVYARP*********LEIHKEFQGIGVTIIEGELDEHKKIVSILKEVDVVISTVAYPQFLDQLEIVHAIKVAGNIKRFLPSEFGCEEDKVRPLPPFEAYLEKKRIVRRAIEAAQIPYTFVSANLCGAYFVNVLLRPFESHDDVVVYGSGEAKVVFNYEEDIAKCTIKEQKIGQSFKRIQVSEEELVKLSHTLPPPEDIPISIMHSLLAKGDSMNFELGEDDIEASKLYPDFKFTTIDQLLDIFLIDPPKP******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVKASVSSGHKTFVYARPVTQNSRPSKLEIHKEFQGIGVTIIEGELDEHKKIVSILKEVDVVISTVAYPQFLDQLEIVHAIKVAGNIKRFLPSEFGCEEDKVRPLPPFEAYLEKKRIVRRAIEAAQIPYTFVSANLCGAYFVNVLLRPFESHDDVVVYGSGEAKVVFNYEEDIAKCTIKEQKIGQSFKRIQVSEEELVKLSHTLPPPEDIPISIMHSLLAKGDSMNFELGEDDIEASKLYPDFKFTTIDQLLDIFLIDPPKPARTAFE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eugenol synthase 1 Catalyzes the synthesis of the phenylpropene eugenol from coniferyl acetate. Phenylpropenes are produced by plants as defense compounds with antimicrobial and antianimal properties, or as floral attractants of pollinators. Eugenol is a characteristic aromatic constituent of spices.probableQ15GI4

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3C1O, chain A
Confidence level:very confident
Coverage over the Query: 1-264
View the alignment between query and template
View the model in PyMOL