BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024417
(268 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3GPI|A Chain A, Structure Of Putative Nad-Dependent EpimeraseDEHYDRATASE
From Methylobacillus Flagellatus
Length = 286
Score = 35.8 bits (81), Expect = 0.026, Method: Compositional matrix adjust.
Identities = 21/72 (29%), Positives = 34/72 (47%), Gaps = 2/72 (2%)
Query: 164 LAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGC 223
L+AL F SS+ +Y DED+P PI + +L+AE ++ +
Sbjct: 93 LSALEGAPLQHVFFVSSTGVYGQEVEEWLDEDTP--PIAKDFSGKRMLEAEALLAAYSST 150
Query: 224 VLRLAGLYKADR 235
+LR +G+Y R
Sbjct: 151 ILRFSGIYGPGR 162
>pdb|1VLV|A Chain A, Crystal Structure Of Ornithine Carbamoyltransferase
(tm1097) From Thermotoga Maritima At 2.25 A Resolution
Length = 325
Score = 28.5 bits (62), Expect = 4.3, Method: Compositional matrix adjust.
Identities = 19/71 (26%), Positives = 32/71 (45%), Gaps = 4/71 (5%)
Query: 200 PIGRSPRTDVLLKAEKVILEFGGCVLRLAGLYKADRGAHV----YWLQKGTVDSRPDHIL 255
P PR+DV + ++++ E G V + L +A GA V W G D + +
Sbjct: 200 PEELKPRSDVFKRCQEIVKETDGSVSFTSNLEEALAGADVVYTDVWASMGEEDKEKERMA 259
Query: 256 NLIHYELPSRL 266
L Y++ R+
Sbjct: 260 LLKPYQVNERV 270
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.135 0.416
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 8,183,684
Number of Sequences: 62578
Number of extensions: 334926
Number of successful extensions: 655
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 655
Number of HSP's gapped (non-prelim): 3
length of query: 268
length of database: 14,973,337
effective HSP length: 97
effective length of query: 171
effective length of database: 8,903,271
effective search space: 1522459341
effective search space used: 1522459341
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)