BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024417
(268 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q68EL6|NFIL3_DANRE Nuclear factor interleukin-3-regulated protein OS=Danio rerio
GN=nfil3 PE=2 SV=1
Length = 462
Score = 30.8 bits (68), Expect = 9.9, Method: Compositional matrix adjust.
Identities = 18/61 (29%), Positives = 29/61 (47%)
Query: 145 YVIFCAPPSRSLDYPGDVRLAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRS 204
Y F +P + YP D+ L+ + + SA+ D SD+ + SP++ I RS
Sbjct: 139 YQDFMSPSATKDSYPSDLEPTRLTSSCISVIKHSPHSALSDGSDSSTVTQGSPLINISRS 198
Query: 205 P 205
P
Sbjct: 199 P 199
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.318 0.133 0.407
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 101,345,381
Number of Sequences: 539616
Number of extensions: 4205042
Number of successful extensions: 10485
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 10470
Number of HSP's gapped (non-prelim): 13
length of query: 268
length of database: 191,569,459
effective HSP length: 115
effective length of query: 153
effective length of database: 129,513,619
effective search space: 19815583707
effective search space used: 19815583707
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)