Citrus Sinensis ID: 024453

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------

MSAGVCGKRVGFEEICGSSSPTSAKRSRCSTFGSLVRSGSDDPVSFLLQMFPDVDPEVVKSVLGEHDNKIEDAIDRLRVLSFSNISERIKSQGLEPTIIGNFSAVPGESATSCSQMSEEEVRSAHTNFCGENITDGSKWVDLFVHEMMSAADLDDARGRAARILEVFERSIITNSKASKELEHASLKEHLQSLLNDNQILKKAVSIQHERHLEQEQKEKEVELLKLVISQYQDQARNLELRNYALKLHLQRAQESSSIPRQFHPDIF

cccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc

*SAGVCGKRVG********************************VSFLLQMFPDVDPEVVKSVLGEHDNKIEDAIDRLRVLSFSN*************************************************TDGSKWVDLFVHEMMSAADLDDARGRAARILEVFERSIIT***********************NQILKKAVSIQH************VELLKLVISQYQDQARNLELRNYALKLHL******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSAGVCGKRVGFEEICGSSSPTSAKRSRCSTFGSLVRSGSDDPVSFLLQMFPDVDPEVVKSVLGEHDNKIEDAIDRLRVLSFSNISERIKSQGLEPTIIGNFSAVPGESATSCSQMSEEEVRSAHTNFCGENITDGSKWVDLFVHEMMSAADLDDARGRAARILEVFERSIITNSKASKELExxxxxxxxxxxxxxxxxxxxxVSIQHERHLExxxxxxxxxxxxxxxxxxxxxxxxxxxxNYALKLHLQRAQESSSIPRQFHPDIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DHY, chain A
Confidence level:confident
Coverage over the Query: 41-85
View the alignment between query and template
View the model in PyMOL

Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 180-252
View the alignment between query and template
View the model in PyMOL

Template: 3HNW, chain A
Confidence level:probable
Coverage over the Query: 134-157,169-242
View the alignment between query and template
View the model in PyMOL