BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024494
         (267 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3GPI|A Chain A, Structure Of Putative Nad-Dependent EpimeraseDEHYDRATASE
           From Methylobacillus Flagellatus
          Length = 286

 Score = 34.7 bits (78), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 164 LAALSWNGEGSFLFTSSSAIYDCSDNGACDEDSPVVPIGRSPRTDVLLKAEKVILEFGGC 223
           L+AL         F SS+ +Y        DED+P  PI +      +L+AE ++  +   
Sbjct: 93  LSALEGAPLQHVFFVSSTGVYGQEVEEWLDEDTP--PIAKDFSGKRMLEAEALLAAYSST 150

Query: 224 VLRLAGLY 231
           +LR +G+Y
Sbjct: 151 ILRFSGIY 158


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.421 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,994,942
Number of Sequences: 62578
Number of extensions: 321086
Number of successful extensions: 616
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 616
Number of HSP's gapped (non-prelim): 2
length of query: 267
length of database: 14,973,337
effective HSP length: 97
effective length of query: 170
effective length of database: 8,903,271
effective search space: 1513556070
effective search space used: 1513556070
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)