Citrus Sinensis ID: 024539

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260------

MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQKANGTAKVGGGEDAEVGFLF

ccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHcHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcHcccccccccHHHHccccccccccccccccccc

*********FVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSS***************RIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTS*************************VGFLF

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MASSKERENFVYxxxxxxxxxxxxxxxxxxxxxAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERAxxxxxxxxxxxxxxxxxxxxxSYKDSTLIMQLLRDNLTLWTSDIPEDGEDAQKANGTAKVGGGEDAEVGFLF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
14-3-3-like protein D		confident	Q96453
14-3-3-like protein GF14-E	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	confident	Q6EUP4
Protein BMH2		confident	P34730

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UBW, chain A
Confidence level:very confident
Coverage over the Query: 6-235
View the alignment between query and template
View the model in PyMOL