BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024545
         (266 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2WTS|A Chain A, Crystal Structure Of Sortase C-1 (Srtc-1) Mutant H131d
           From S. Pneumoniae
 pdb|2WTS|B Chain B, Crystal Structure Of Sortase C-1 (Srtc-1) Mutant H131d
           From S. Pneumoniae
          Length = 213

 Score = 30.8 bits (68), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%)

Query: 211 FFVH-----MAIHFDQVKEIFPLGFYSLLVVP 237
           F+VH     MA   DQVK I P  F  LL+VP
Sbjct: 137 FYVHNIKEVMAYQVDQVKVIEPTNFDDLLIVP 168


>pdb|2W1J|A Chain A, Crystal Structure Of Sortase C-1 (Srtc-1) From
           Streptococcus Pneumoniae
 pdb|2W1J|B Chain B, Crystal Structure Of Sortase C-1 (Srtc-1) From
           Streptococcus Pneumoniae
          Length = 212

 Score = 30.8 bits (68), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 18/32 (56%), Gaps = 5/32 (15%)

Query: 211 FFVH-----MAIHFDQVKEIFPLGFYSLLVVP 237
           F+VH     MA   DQVK I P  F  LL+VP
Sbjct: 136 FYVHNIKEVMAYQVDQVKVIEPTNFDDLLIVP 167


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.143    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,601,792
Number of Sequences: 62578
Number of extensions: 223725
Number of successful extensions: 442
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 436
Number of HSP's gapped (non-prelim): 8
length of query: 266
length of database: 14,973,337
effective HSP length: 97
effective length of query: 169
effective length of database: 8,903,271
effective search space: 1504652799
effective search space used: 1504652799
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)