Citrus Sinensis ID: 024592

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----

MYSGEFDGAAAFAGGGFMPSQATTVPDPSSSFSKNRNVRTLLPMTVKQLSELSSNDESSASIDGADVNTITVVGIVCDMQDKEPQFIFLIDDGTGRIECSRWAHEQMEFNEVNQISKGMYVRVYGHLKAFQDKRSLNAYSLRPIIDFNEITSHFVECIYVQLYNTRLRGGSSNQPQMTNSNHLKEYNAISSNHYSFDEGKSIDQMVLDFLRRPEFLANNNGVHRNVISQQLNLPMDKLMEALESLNENSLVYSIDEFHYKSAVNA

ccccccccccccccccccccccccccccccccccccccccEEEEEHHHHHcccccccccEEEccEEEEEEEEEEEEEEEECcccEEEEEEEccccEEEEEEccccccccccccccccccEEEEEEEEEECccCEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHccccHHHHHHHHHHHHHccEEEEEEcccCECcccc

**********AF******************************PMTVKQLSELSSNDESSASIDGADVNTITVVGIVCDMQDKEPQFIFLIDDGTGRIECSRWAHEQMEFNEVNQISKGMYVRVYGHLKAFQDKRSLNAYSLRPIIDFNEITSHFVECIYVQLYNTRL********************************KSIDQMVLDFLRRPEFLANNNGVHRNVISQQLNLPMDKLMEALESLNENSLVYSIDEFHYKSAVN*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Replication protein A 32 kDa subunit B	Component of the replication protein A complex (RP-A) required for DNA recombination, repair and replication. The activity of RP-A is mediated by single-stranded DNA binding and protein interactions. Required fo cell division in meristems. Involved in the maintenance of transcriptional epigenetic gene silencing (TGS) at specific loci (including some transposons) by regulating histone H3 acetylation, 'Lys-4' and 'Lys-9' methylation.	probable	Q8LFJ8

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PI2, chain A
Confidence level:very confident
Coverage over the Query: 36-171
View the alignment between query and template
View the model in PyMOL