BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024609
(265 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2WDC|A Chain A, Termus Thermophilus Sulfate Thiohydrolase Soxb In Complex
With Glycerol
pdb|2WDD|A Chain A, Termus Thermophilus Sulfate Thiohydrolase Soxb In Complex
With Sulfate
pdb|2WDE|A Chain A, Termus Thermophilus Sulfate Thiohydrolase Soxb In Complex
With Thiosulfate
pdb|2WDF|A Chain A, Termus Thermophilus Sulfate Thiohydrolase Soxb
Length = 562
Score = 29.6 bits (65), Expect = 1.6, Method: Compositional matrix adjust.
Identities = 14/33 (42%), Positives = 20/33 (60%)
Query: 163 VRTLKQGSRPIDPDPHCLVSPVDGIVLRVGELK 195
VR ++ G RP+DP+ L + G + RVGE K
Sbjct: 486 VREVEVGGRPLDPNRRYLAAAYGGRLQRVGEAK 518
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.136 0.420
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,830,823
Number of Sequences: 62578
Number of extensions: 231281
Number of successful extensions: 447
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 446
Number of HSP's gapped (non-prelim): 1
length of query: 265
length of database: 14,973,337
effective HSP length: 97
effective length of query: 168
effective length of database: 8,903,271
effective search space: 1495749528
effective search space used: 1495749528
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)