Citrus Sinensis ID: 024622

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-----
MDVQFGSHTLRSHGVVVARKHMHDWLIFLFLVVMDIILNAIDPFYRFVGKDMMTDLKYPFKNNTVPVWAVPVYAVLVPVIIFLIVYYHRRDVYDLHHAILGLLYSVLVTGVLTDAIKIAVGRPRPNFFWRCFPDGIAVYDQFNNVICHGDKHVVNEGHKSFPSGHTSWSFAGLGFLSLYISGKIKAFDRRGHVAKLCLVFLPLLFASLVGISRVDDYWHHWQDVFAGGLLGLVVATFCYLQFFPPPYHAEGTVQVFEMIPLVLIR
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEcccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHEEccccccccccccccccccccccccc
*********LRSHGVVVARKHMHDWLIFLFLVVMDIILNAIDPFYRFVGKDMMTDLKYPFKNNTVPVWAVPVYAVLVPVIIFLIVYYHRRDVYDLHHAILGLLYSVLVTGVLTDAIKIAVGRPRPNFFWRCFPDGIAVYDQFNNVICHGDKHVVNEGHKSFPSGHTSWSFAGLGFLSLYISGKIKAFDRRGHVAKLCLVFLPLLFASLVGISRVDDYWHHWQDVFAGGLLGLVVATFCYLQFFPPPYHAEGTVQVFEMIPLVLI*
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVQFGSHTLRSHGVVVARKHMHDWLIFLFLVVMDIILNAIDPFYRFVGKDMMTDLKYPFKNNTVPVWAVPVYAVLVPVIIFLIVYYHRRDVYDLHHAILGLLYSVLVTGVLTDAIKIAVGRPRPNFFWRCFPDGIAVYDQFNNVICHGDKHVVNEGHKSFPSGHTSWSFAGLGFLSLYISGKIKAFDRRGHVAKLCLVFLPLLFASLVGISRVDDYWHHWQDVFAGGLLGLVVATFCYLQFFPPPYHAEGTVQVFEMIPLVLIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative lipid phosphate phosphatase 3, chloroplastic probableQ8LFD1
Phosphatidate phosphatase PPAPDC1B Displays magnesium-independent phosphatidate phosphatase activity in vitro. Catalyzes the conversion of phosphatidic acid to diacylglycerol.probableQ3UMZ3
Lipid phosphate phosphatase 2 May play a general "housekeeping role" in lipid metabolism. Exhibits both diacylglycerol pyrophosphate (DGPP) phosphatase and phosphatidate (PA) phosphatase activities with no preference for either substrate.probableQ9XI60

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IPB, chain A
Confidence level:very confident
Coverage over the Query: 111-130,144-183,194-239
View the alignment between query and template
View the model in PyMOL
Template: 3BB0, chain A
Confidence level:confident
Coverage over the Query: 104-234
View the alignment between query and template
View the model in PyMOL