Query         024658
Match_columns 264
No_of_seqs    157 out of 429
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 06:24:42 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/024658.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/024658hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00021 BBOX B-Box-type zinc f  97.4 0.00013 2.8E-09   47.4   2.4   38    2-45      1-39  (39)
  2 smart00336 BBOX B-Box-type zin  96.8  0.0012 2.6E-08   43.3   2.7   39    1-45      3-42  (42)
  3 PF00643 zf-B_box:  B-box zinc   96.5  0.0014 2.9E-08   43.8   1.4   39    1-45      3-42  (42)
  4 PF06524 NOA36:  NOA36 protein;  96.3  0.0034 7.4E-08   59.3   3.3   12  111-122   279-290 (314)
  5 KOG4367 Predicted Zn-finger pr  96.2  0.0012 2.6E-08   66.2   0.2   74    3-76    164-253 (699)
  6 cd00021 BBOX B-Box-type zinc f  96.2  0.0027 5.8E-08   41.1   1.5   37   49-86      3-39  (39)
  7 KOG0585 Ca2+/calmodulin-depend  96.2   0.002 4.3E-08   65.2   1.2   51  200-252   192-242 (576)
  8 KOG0198 MEKK and related serin  95.9   0.003 6.6E-08   59.8   1.1   29  224-252   121-149 (313)
  9 KOG4279 Serine/threonine prote  95.6  0.0028 6.2E-08   67.0  -0.2   50  200-259   665-719 (1226)
 10 KOG0581 Mitogen-activated prot  95.4  0.0073 1.6E-07   58.8   1.5   30  223-252   181-211 (364)
 11 smart00336 BBOX B-Box-type zin  95.3   0.012 2.7E-07   38.4   2.0   40   42-85      2-41  (42)
 12 PF06524 NOA36:  NOA36 protein;  95.1   0.019   4E-07   54.5   3.2    8   59-66    183-190 (314)
 13 PF09026 CENP-B_dimeris:  Centr  95.0  0.0063 1.4E-07   49.8   0.0    6  135-140    40-45  (101)
 14 PF10446 DUF2457:  Protein of u  94.8   0.019 4.1E-07   57.3   2.6   16  234-249   217-232 (458)
 15 KOG0575 Polo-like serine/threo  94.6  0.0099 2.1E-07   60.9   0.0   36  217-252   115-150 (592)
 16 PF00643 zf-B_box:  B-box zinc   94.6    0.02 4.3E-07   38.1   1.5   37   48-85      5-41  (42)
 17 KOG0615 Serine/threonine prote  94.3   0.018   4E-07   57.4   1.2   35  218-252   274-308 (475)
 18 PF09026 CENP-B_dimeris:  Centr  93.7   0.018 3.9E-07   47.1   0.0   14  125-138    33-46  (101)
 19 PHA02882 putative serine/threo  93.7   0.032 6.9E-07   49.2   1.5   29  224-252   130-158 (294)
 20 PF10446 DUF2457:  Protein of u  93.6    0.04 8.7E-07   55.0   2.1   16  176-191   188-203 (458)
 21 cd07868 STKc_CDK8 Catalytic do  93.5   0.034 7.3E-07   48.9   1.3   29  224-252   112-140 (317)
 22 KOG0592 3-phosphoinositide-dep  93.4   0.036 7.8E-07   56.9   1.5   28  225-252   179-206 (604)
 23 cd07867 STKc_CDC2L6 Catalytic   93.3    0.04 8.7E-07   48.2   1.4   29  224-252   112-140 (317)
 24 KOG0943 Predicted ubiquitin-pr  93.2   0.055 1.2E-06   60.1   2.6   18   89-106  1730-1747(3015)
 25 KOG1035 eIF-2alpha kinase GCN2  93.2   0.033 7.3E-07   61.3   1.0   27  226-252   703-729 (1351)
 26 cd07862 STKc_CDK6 Catalytic do  93.1   0.042   9E-07   47.5   1.2   29  224-252   114-142 (290)
 27 cd05037 PTK_Jak_rpt1 Pseudokin  93.1    0.04 8.6E-07   46.2   1.0   30  223-252   104-133 (259)
 28 cd07871 STKc_PCTAIRE3 Catalyti  93.1   0.048   1E-06   47.7   1.6   29  224-252   107-135 (288)
 29 cd05102 PTKc_VEGFR3 Catalytic   92.9   0.042 9.2E-07   49.0   1.1   28  225-252   179-206 (338)
 30 cd05631 STKc_GRK4 Catalytic do  92.8    0.05 1.1E-06   47.5   1.3   30  223-252   105-134 (285)
 31 cd07859 STKc_TDY_MAPK_plant Ca  92.8   0.053 1.2E-06   47.8   1.4   29  224-252   107-135 (338)
 32 cd05571 STKc_PKB Catalytic dom  92.7   0.051 1.1E-06   48.7   1.3   28  225-252   100-127 (323)
 33 cd05614 STKc_MSK2_N N-terminal  92.7   0.056 1.2E-06   48.3   1.4   28  225-252   110-137 (332)
 34 cd05575 STKc_SGK Catalytic dom  92.6   0.054 1.2E-06   48.4   1.3   28  225-252   101-128 (323)
 35 cd05593 STKc_PKB_gamma Catalyt  92.5   0.057 1.2E-06   48.7   1.3   28  225-252   100-127 (328)
 36 cd05602 STKc_SGK1 Catalytic do  92.5   0.059 1.3E-06   48.2   1.4   28  225-252   101-128 (325)
 37 cd05078 PTK_Jak2_Jak3_rpt1 Pse  92.2   0.059 1.3E-06   46.0   1.0   29  225-253   105-133 (258)
 38 cd05042 PTKc_Aatyk Catalytic d  92.2   0.067 1.5E-06   45.7   1.3   29  224-252   104-132 (269)
 39 cd05628 STKc_NDR1 Catalytic do  92.2   0.065 1.4E-06   48.9   1.3   31  222-252   103-133 (363)
 40 cd05108 PTKc_EGFR Catalytic do  92.2   0.066 1.4E-06   47.4   1.3   28  225-252   114-141 (316)
 41 PHA03212 serine/threonine kina  92.2   0.069 1.5E-06   50.2   1.5   29  224-252   186-214 (391)
 42 cd07878 STKc_p38beta_MAPK11 Ca  92.2   0.062 1.4E-06   48.2   1.1   29  224-252   122-150 (343)
 43 cd05621 STKc_ROCK2 Catalytic d  92.2   0.066 1.4E-06   49.7   1.3   28  225-252   147-174 (370)
 44 cd05629 STKc_NDR_like_fungal C  92.1   0.069 1.5E-06   48.9   1.4   27  226-252   107-133 (377)
 45 cd07869 STKc_PFTAIRE1 Catalyti  92.1   0.068 1.5E-06   47.0   1.2   28  225-252   108-135 (303)
 46 cd05586 STKc_Sck1_like Catalyt  92.1   0.067 1.4E-06   47.8   1.2   28  225-252   101-128 (330)
 47 cd05076 PTK_Tyk2_rpt1 Pseudoki  92.1   0.075 1.6E-06   46.3   1.5   30  223-252   120-149 (274)
 48 PTZ00036 glycogen synthase kin  92.1    0.07 1.5E-06   51.0   1.4   27  226-252   176-202 (440)
 49 cd08226 PK_STRAD_beta Pseudoki  92.0   0.071 1.5E-06   47.6   1.3   29  224-252   105-133 (328)
 50 KOG0658 Glycogen synthase kina  92.0   0.058 1.3E-06   52.7   0.8   34  225-258   130-168 (364)
 51 cd05585 STKc_YPK1_like Catalyt  92.0   0.075 1.6E-06   47.3   1.4   28  225-252    98-125 (312)
 52 cd07874 STKc_JNK3 Catalytic do  92.0   0.077 1.7E-06   47.9   1.5   28  225-252   124-151 (355)
 53 cd05587 STKc_cPKC Catalytic do  91.9   0.076 1.6E-06   47.5   1.3   30  223-252   104-133 (324)
 54 cd05626 STKc_LATS2 Catalytic d  91.9   0.072 1.6E-06   49.1   1.2   27  226-252   107-133 (381)
 55 cd05603 STKc_SGK2 Catalytic do  91.9   0.075 1.6E-06   47.4   1.3   28  225-252   101-128 (321)
 56 PHA03210 serine/threonine kina  91.9   0.076 1.6E-06   51.8   1.4   28  225-252   272-299 (501)
 57 PLN00181 protein SPA1-RELATED;  91.8    0.07 1.5E-06   54.8   1.2   29  224-252    84-112 (793)
 58 PHA03207 serine/threonine kina  91.7   0.085 1.8E-06   49.0   1.5   29  224-252   189-217 (392)
 59 cd07863 STKc_CDK4 Catalytic do  91.7   0.083 1.8E-06   45.4   1.3   29  224-252   112-140 (288)
 60 cd08227 PK_STRAD_alpha Pseudok  91.7   0.074 1.6E-06   47.5   1.0   28  225-252   106-133 (327)
 61 cd05591 STKc_nPKC_epsilon Cata  91.6   0.086 1.9E-06   47.1   1.4   28  225-252   101-128 (321)
 62 cd07876 STKc_JNK2 Catalytic do  91.6   0.087 1.9E-06   47.8   1.5   28  225-252   128-155 (359)
 63 cd05598 STKc_LATS Catalytic do  91.6    0.08 1.7E-06   48.3   1.2   27  226-252   107-133 (376)
 64 cd05620 STKc_nPKC_delta Cataly  91.6   0.087 1.9E-06   47.2   1.4   28  225-252   101-128 (316)
 65 PTZ00284 protein kinase; Provi  91.6   0.087 1.9E-06   50.2   1.4   29  225-253   236-265 (467)
 66 PLN03225 Serine/threonine-prot  91.5   0.082 1.8E-06   53.1   1.3   27  226-252   261-287 (566)
 67 PHA03209 serine/threonine kina  91.5   0.089 1.9E-06   48.1   1.4   28  225-252   162-189 (357)
 68 cd05612 STKc_PRKX_like Catalyt  91.5   0.091   2E-06   46.2   1.4   29  224-252   105-133 (291)
 69 cd07853 STKc_NLK Catalytic dom  91.5   0.094   2E-06   47.9   1.5   28  225-252   108-135 (372)
 70 cd05595 STKc_PKB_beta Catalyti  91.5   0.085 1.8E-06   47.4   1.2   29  224-252    99-127 (323)
 71 cd05109 PTKc_HER2 Catalytic do  91.5   0.078 1.7E-06   45.6   0.9   30  223-252   112-141 (279)
 72 cd05075 PTKc_Axl Catalytic dom  91.5   0.089 1.9E-06   44.7   1.2   28  225-252   117-144 (272)
 73 KOG0660 Mitogen-activated prot  91.4   0.079 1.7E-06   51.7   1.0   31  222-252   127-157 (359)
 74 cd07872 STKc_PCTAIRE2 Catalyti  91.4   0.097 2.1E-06   46.1   1.5   28  225-252   109-136 (309)
 75 cd05573 STKc_ROCK_NDR_like Cat  91.4   0.091   2E-06   46.9   1.3   27  226-252   107-133 (350)
 76 cd05599 STKc_NDR_like Catalyti  91.4   0.092   2E-06   47.5   1.3   28  225-252   106-133 (364)
 77 cd05604 STKc_SGK3 Catalytic do  91.3   0.093   2E-06   46.9   1.2   28  225-252   101-128 (325)
 78 cd05096 PTKc_DDR1 Catalytic do  91.2     0.1 2.2E-06   45.8   1.4   29  224-252   142-170 (304)
 79 cd05625 STKc_LATS1 Catalytic d  91.2   0.097 2.1E-06   48.0   1.3   27  226-252   107-133 (382)
 80 PTZ00263 protein kinase A cata  91.2   0.099 2.1E-06   47.1   1.3   27  226-252   124-150 (329)
 81 cd05616 STKc_cPKC_beta Catalyt  91.1     0.1 2.2E-06   46.7   1.3   30  223-252   104-133 (323)
 82 cd05592 STKc_nPKC_theta_delta   91.1     0.1 2.3E-06   46.7   1.3   28  225-252   101-128 (316)
 83 PLN00034 mitogen-activated pro  91.0     0.1 2.2E-06   47.3   1.3   29  224-252   172-200 (353)
 84 KOG0600 Cdc2-related protein k  91.0   0.097 2.1E-06   53.4   1.2   34  219-252   217-250 (560)
 85 cd07857 STKc_MPK1 Catalytic do  91.0    0.12 2.5E-06   46.3   1.6   29  224-252   109-137 (332)
 86 cd05091 PTKc_Ror2 Catalytic do  91.0     0.1 2.2E-06   44.9   1.1   28  225-252   129-156 (283)
 87 cd05086 PTKc_Aatyk2 Catalytic   91.0   0.097 2.1E-06   45.0   1.0   27  226-252   105-131 (268)
 88 cd05077 PTK_Jak1_rpt1 Pseudoki  90.9    0.11 2.4E-06   44.8   1.3   32  222-253   107-138 (262)
 89 cd05608 STKc_GRK1 Catalytic do  90.9    0.12 2.6E-06   45.0   1.5   29  224-252   101-129 (280)
 90 cd05601 STKc_CRIK Catalytic do  90.9     0.1 2.2E-06   46.5   1.1   27  226-252   108-134 (330)
 91 cd05584 STKc_p70S6K Catalytic   90.9    0.11 2.4E-06   46.6   1.3   28  225-252   105-132 (323)
 92 cd07875 STKc_JNK1 Catalytic do  90.8    0.11 2.5E-06   47.1   1.4   28  225-252   131-158 (364)
 93 KOG0579 Ste20-like serine/thre  90.8   0.072 1.6E-06   56.4   0.0   48  193-252   115-162 (1187)
 94 cd05046 PTK_CCK4 Pseudokinase   90.7    0.11 2.3E-06   44.4   1.0   30  223-252   120-149 (275)
 95 cd05596 STKc_ROCK Catalytic do  90.7    0.12 2.5E-06   47.8   1.3   27  226-252   148-174 (370)
 96 cd05590 STKc_nPKC_eta Catalyti  90.7    0.12 2.6E-06   46.4   1.4   29  224-252   100-128 (320)
 97 cd05622 STKc_ROCK1 Catalytic d  90.7    0.11 2.5E-06   48.0   1.2   28  225-252   147-174 (371)
 98 KOG0578 p21-activated serine/t  90.6   0.092   2E-06   53.7   0.6   35  219-253   368-402 (550)
 99 cd05582 STKc_RSK_N N-terminal   90.6    0.12 2.6E-06   46.0   1.3   28  225-252   103-130 (318)
100 PTZ00426 cAMP-dependent protei  90.5    0.12 2.7E-06   47.3   1.3   29  224-252   135-163 (340)
101 PHA03211 serine/threonine kina  90.5    0.12 2.6E-06   50.6   1.2   28  225-252   265-292 (461)
102 cd05081 PTKc_Jak2_Jak3_rpt2 Ca  90.4    0.13 2.8E-06   44.3   1.3   30  223-252   111-140 (284)
103 cd05627 STKc_NDR2 Catalytic do  90.4    0.12 2.7E-06   46.9   1.2   28  225-252   106-133 (360)
104 KOG0664 Nemo-like MAPK-related  90.4     0.1 2.2E-06   50.8   0.7   28  225-252   161-188 (449)
105 cd05576 STKc_RPK118_like Catal  90.4    0.13 2.9E-06   43.6   1.3   31  222-252    87-117 (237)
106 cd05106 PTKc_CSF-1R Catalytic   90.3    0.12 2.6E-06   48.0   1.0   29  224-252   216-244 (374)
107 cd05064 PTKc_EphR_A10 Catalyti  90.3    0.12 2.6E-06   44.4   1.0   31  222-252   109-139 (266)
108 cd07848 STKc_CDKL5 Catalytic d  90.2    0.14 2.9E-06   44.2   1.3   29  224-252   104-132 (287)
109 cd05600 STKc_Sid2p_Dbf2p Catal  90.2    0.14 3.1E-06   45.8   1.4   28  225-252   106-133 (333)
110 KOG0192 Tyrosine kinase specif  90.2    0.12 2.7E-06   49.6   1.0   30  223-252   145-175 (362)
111 cd05597 STKc_DMPK_like Catalyt  90.2    0.14   3E-06   46.2   1.3   28  225-252   107-134 (331)
112 cd05074 PTKc_Tyro3 Catalytic d  90.2    0.13 2.8E-06   43.8   1.0   31  223-253   116-146 (273)
113 cd05035 PTKc_Axl_like Catalyti  90.2    0.13 2.7E-06   43.6   1.0   28  225-252   118-145 (273)
114 cd05589 STKc_PKN Catalytic dom  90.1    0.14   3E-06   45.8   1.3   31  222-252   103-133 (324)
115 cd05624 STKc_MRCK_beta Catalyt  90.0    0.13 2.9E-06   46.3   1.1   27  226-252   108-134 (331)
116 cd05633 STKc_GRK3 Catalytic do  90.0    0.14 3.1E-06   44.7   1.2   29  224-252   101-129 (279)
117 cd05570 STKc_PKC Catalytic dom  90.0    0.15 3.3E-06   45.5   1.4   29  224-252   100-128 (318)
118 cd05618 STKc_aPKC_iota Catalyt  90.0    0.15 3.2E-06   46.1   1.3   29  224-252   100-128 (329)
119 cd05623 STKc_MRCK_alpha Cataly  89.9    0.14   3E-06   46.1   1.1   28  225-252   107-134 (332)
120 KOG0594 Protein kinase PCTAIRE  89.9    0.14   3E-06   49.4   1.1   29  224-252   124-152 (323)
121 cd05619 STKc_nPKC_theta Cataly  89.9    0.15 3.3E-06   45.8   1.4   28  225-252   101-128 (316)
122 cd05111 PTK_HER3 Pseudokinase   89.9    0.13 2.9E-06   44.6   0.9   28  225-252   114-141 (279)
123 cd00192 PTKc Catalytic domain   89.9    0.15 3.3E-06   42.3   1.2   30  223-252   108-137 (262)
124 cd05617 STKc_aPKC_zeta Catalyt  89.8    0.16 3.4E-06   45.8   1.3   29  224-252   100-128 (327)
125 cd05080 PTKc_Tyk2_rpt2 Catalyt  89.8    0.13 2.9E-06   44.3   0.8   29  224-252   111-139 (283)
126 cd07861 STKc_CDK1_euk Catalyti  89.7    0.16 3.5E-06   43.5   1.3   30  223-252   104-133 (285)
127 cd05051 PTKc_DDR Catalytic dom  89.7    0.16 3.4E-06   43.9   1.2   27  226-252   136-162 (296)
128 cd05089 PTKc_Tie1 Catalytic do  89.6    0.15 3.2E-06   44.8   1.0   28  225-252   124-151 (297)
129 cd05594 STKc_PKB_alpha Catalyt  89.6    0.14 3.1E-06   45.7   1.0   28  225-252   100-128 (325)
130 cd05147 RIO1_euk RIO kinase fa  89.6    0.17 3.7E-06   43.4   1.4   28  225-252   122-150 (190)
131 cd08216 PK_STRAD Pseudokinase   89.6    0.14 3.1E-06   44.8   0.9   28  225-252   106-133 (314)
132 cd05084 PTKc_Fes Catalytic dom  89.5    0.17 3.6E-06   42.7   1.3   30  223-252    97-126 (252)
133 cd05632 STKc_GRK5 Catalytic do  89.5    0.16 3.6E-06   44.3   1.2   30  223-252   105-134 (285)
134 cd05053 PTKc_FGFR Catalytic do  89.5    0.13 2.9E-06   44.4   0.6   28  225-252   137-164 (293)
135 cd05052 PTKc_Abl Catalytic dom  89.4    0.15 3.3E-06   43.4   0.9   28  225-252   109-136 (263)
136 PF00069 Pkinase:  Protein kina  89.4    0.17 3.7E-06   42.3   1.2   30  223-252   101-130 (260)
137 cd05094 PTKc_TrkC Catalytic do  89.3    0.16 3.4E-06   44.3   0.9   30  223-252   126-155 (291)
138 cd05048 PTKc_Ror Catalytic Dom  89.2    0.16 3.6E-06   43.5   1.0   28  225-252   129-156 (283)
139 cd07837 STKc_CdkB_plant Cataly  89.2    0.18 3.9E-06   43.5   1.2   32  221-252   111-142 (295)
140 cd05588 STKc_aPKC Catalytic do  89.1    0.19   4E-06   45.3   1.3   29  224-252   100-128 (329)
141 cd07839 STKc_CDK5 Catalytic do  89.1    0.19 4.1E-06   43.1   1.3   32  221-252   100-131 (284)
142 cd05101 PTKc_FGFR2 Catalytic d  89.1    0.17 3.6E-06   44.4   1.0   28  225-252   142-169 (304)
143 cd05082 PTKc_Csk Catalytic dom  89.1    0.17 3.6E-06   42.9   0.9   28  225-252   107-134 (256)
144 PTZ00267 NIMA-related protein   89.1    0.17 3.7E-06   48.8   1.1   28  225-252   174-201 (478)
145 cd05093 PTKc_TrkB Catalytic do  89.1    0.18 3.8E-06   43.9   1.1   31  222-252   122-152 (288)
146 cd05116 PTKc_Syk Catalytic dom  89.0    0.18 3.9E-06   42.9   1.1   29  224-252    99-127 (257)
147 cd06624 STKc_ASK Catalytic dom  89.0     0.2 4.2E-06   42.8   1.3   28  225-252   113-140 (268)
148 cd06658 STKc_PAK5 Catalytic do  89.0     0.2 4.3E-06   44.2   1.3   29  224-252   122-150 (292)
149 cd07843 STKc_CDC2L1 Catalytic   89.0    0.19 4.1E-06   43.6   1.2   31  222-252   108-138 (293)
150 PTZ00283 serine/threonine prot  89.0    0.19   4E-06   49.2   1.3   28  225-252   148-175 (496)
151 cd07870 STKc_PFTAIRE2 Catalyti  88.9    0.22 4.7E-06   43.1   1.6   29  224-252   107-135 (291)
152 cd05615 STKc_cPKC_alpha Cataly  88.9     0.2 4.3E-06   45.0   1.3   30  223-252   104-133 (323)
153 cd05092 PTKc_TrkA Catalytic do  88.7     0.2 4.4E-06   43.4   1.2   29  224-252   126-154 (280)
154 cd07847 STKc_CDKL1_4 Catalytic  88.7     0.2 4.4E-06   42.7   1.2   32  221-252   101-132 (286)
155 cd05090 PTKc_Ror1 Catalytic do  88.7    0.17 3.8E-06   43.6   0.8   29  224-252   128-156 (283)
156 cd05104 PTKc_Kit Catalytic dom  88.6    0.21 4.5E-06   46.3   1.3   29  224-252   218-246 (375)
157 cd05607 STKc_GRK7 Catalytic do  88.6     0.2 4.4E-06   43.5   1.1   28  225-252   100-127 (277)
158 cd05054 PTKc_VEGFR Catalytic d  88.5     0.2 4.4E-06   45.6   1.1   29  224-252   177-205 (337)
159 cd05110 PTKc_HER4 Catalytic do  88.3    0.21 4.6E-06   44.0   1.1   29  224-252   113-141 (303)
160 cd05055 PTKc_PDGFR Catalytic d  88.2    0.18 3.9E-06   44.6   0.6   30  223-252   144-173 (302)
161 cd05040 PTKc_Ack_like Catalyti  88.2    0.21 4.6E-06   42.1   1.0   28  225-252   102-129 (257)
162 cd05115 PTKc_Zap-70 Catalytic   88.2     0.2 4.4E-06   42.9   0.8   29  224-252    99-127 (257)
163 KOG0666 Cyclin C-dependent kin  88.2    0.17 3.8E-06   49.7   0.5   27  226-252   138-164 (438)
164 cd05088 PTKc_Tie2 Catalytic do  88.2    0.23 4.9E-06   43.9   1.2   31  223-253   127-157 (303)
165 cd05095 PTKc_DDR2 Catalytic do  88.1    0.21 4.6E-06   43.6   1.0   29  224-252   134-162 (296)
166 KOG0659 Cdk activating kinase   88.0    0.15 3.2E-06   48.9  -0.1   40  213-252    94-133 (318)
167 cd06630 STKc_MEKK1 Catalytic d  88.0    0.25 5.5E-06   41.7   1.3   29  225-253   108-136 (268)
168 KOG0598 Ribosomal protein S6 k  88.0    0.24 5.2E-06   48.4   1.3   35  226-260   131-177 (357)
169 cd06645 STKc_MAP4K3 Catalytic   88.0    0.26 5.6E-06   41.9   1.4   29  224-252   110-138 (267)
170 cd05045 PTKc_RET Catalytic dom  88.0     0.2 4.3E-06   43.5   0.7   30  223-252   130-159 (290)
171 cd07844 STKc_PCTAIRE_like Cata  87.9    0.25 5.5E-06   42.6   1.3   29  224-252   107-135 (291)
172 cd05118 STKc_CMGC Catalytic do  87.9    0.25 5.5E-06   42.0   1.2   29  224-252   102-130 (283)
173 cd05103 PTKc_VEGFR2 Catalytic   87.8    0.21 4.6E-06   45.2   0.8   29  224-252   183-211 (343)
174 cd07849 STKc_ERK1_2_like Catal  87.7    0.26 5.6E-06   44.2   1.3   28  225-252   111-138 (336)
175 cd05049 PTKc_Trk Catalytic dom  87.7    0.24 5.3E-06   42.2   1.0   31  222-252   124-154 (280)
176 cd05043 PTK_Ryk Pseudokinase d  87.6    0.23   5E-06   42.6   0.9   28  225-252   122-149 (280)
177 cd05145 RIO1_like RIO kinase f  87.6    0.26 5.6E-06   41.6   1.2   30  223-252   120-150 (190)
178 PRK10345 hypothetical protein;  87.5    0.26 5.6E-06   43.7   1.1   27  226-252   110-137 (210)
179 cd05062 PTKc_IGF-1R Catalytic   87.5    0.27 5.8E-06   42.3   1.2   27  226-252   125-151 (277)
180 cd05579 STKc_MAST_like Catalyt  87.5    0.28 6.1E-06   40.9   1.3   29  224-252    97-125 (265)
181 cd05058 PTKc_Met_Ron Catalytic  87.5    0.26 5.6E-06   41.7   1.1   27  226-252   104-130 (262)
182 cd05605 STKc_GRK4_like Catalyt  87.4    0.28   6E-06   42.9   1.3   29  224-252   106-134 (285)
183 cd05630 STKc_GRK6 Catalytic do  87.4    0.27 5.8E-06   43.1   1.2   29  224-252   106-134 (285)
184 cd07842 STKc_CDK8_like Catalyt  87.4    0.28   6E-06   42.7   1.2   28  225-252   113-140 (316)
185 cd05038 PTKc_Jak_rpt2 Catalyti  87.4    0.29 6.3E-06   41.6   1.4   30  223-252   112-141 (284)
186 cd05036 PTKc_ALK_LTK Catalytic  87.4    0.23 4.9E-06   42.9   0.7   29  225-253   121-149 (277)
187 cd05032 PTKc_InsR_like Catalyt  87.4    0.25 5.5E-06   42.1   1.0   28  225-252   124-151 (277)
188 cd05610 STKc_MASTL Catalytic d  87.4    0.26 5.7E-06   50.1   1.2   29  224-252   108-136 (669)
189 KOG1187 Serine/threonine prote  87.3    0.31 6.8E-06   46.4   1.7   26  227-252   181-209 (361)
190 KOG0201 Serine/threonine prote  87.3    0.25 5.5E-06   49.6   1.1   26  227-252   118-143 (467)
191 cd06625 STKc_MEKK3_like Cataly  87.3    0.31 6.6E-06   41.1   1.4   29  224-252   108-136 (263)
192 cd05611 STKc_Rim15_like Cataly  87.2    0.31 6.8E-06   41.2   1.5   28  225-252   102-129 (260)
193 cd07841 STKc_CDK7 Catalytic do  87.2     0.3 6.4E-06   42.4   1.3   29  224-252   106-134 (298)
194 cd05039 PTKc_Csk_like Catalyti  87.2    0.23 5.1E-06   41.9   0.7   29  224-252   106-134 (256)
195 cd08223 STKc_Nek4 Catalytic do  87.2    0.28 6.1E-06   41.2   1.2   30  223-252   105-134 (257)
196 cd05606 STKc_beta_ARK Catalyti  87.1     0.3 6.4E-06   42.5   1.3   29  224-252   101-129 (278)
197 cd05059 PTKc_Tec_like Catalyti  87.1    0.29 6.2E-06   41.6   1.1   29  224-252   104-132 (256)
198 cd08220 STKc_Nek8 Catalytic do  87.0    0.32 6.9E-06   40.7   1.3   27  226-252   107-133 (256)
199 cd06637 STKc_TNIK Catalytic do  86.9    0.32 6.9E-06   41.3   1.4   28  225-252   116-143 (272)
200 cd07873 STKc_PCTAIRE1 Catalyti  86.9    0.34 7.3E-06   42.4   1.5   28  225-252   109-136 (301)
201 cd06646 STKc_MAP4K5 Catalytic   86.9    0.34 7.3E-06   41.2   1.5   29  224-252   110-138 (267)
202 cd05044 PTKc_c-ros Catalytic d  86.9    0.28 6.1E-06   41.6   1.0   29  224-252   110-138 (269)
203 cd05100 PTKc_FGFR3 Catalytic d  86.9    0.28 6.1E-06   44.0   1.0   28  226-253   140-167 (334)
204 cd05067 PTKc_Lck_Blk Catalytic  86.8    0.33 7.2E-06   41.2   1.4   29  224-252   106-134 (260)
205 cd05041 PTKc_Fes_like Catalyti  86.7    0.28   6E-06   41.2   0.8   28  225-252    98-125 (251)
206 PRK09188 serine/threonine prot  86.7    0.28   6E-06   47.3   1.0   29  224-252   115-144 (365)
207 cd05061 PTKc_InsR Catalytic do  86.7     0.3 6.5E-06   42.5   1.1   27  226-252   125-151 (288)
208 cd06659 STKc_PAK6 Catalytic do  86.7    0.34 7.4E-06   42.8   1.4   30  223-252   120-149 (297)
209 cd08529 STKc_FA2-like Catalyti  86.6    0.31 6.7E-06   40.8   1.1   28  225-252   106-133 (256)
210 cd05113 PTKc_Btk_Bmx Catalytic  86.5     0.3 6.5E-06   41.7   1.0   29  224-252   104-132 (256)
211 cd06653 STKc_MEKK3_like_1 Cata  86.5    0.36 7.7E-06   41.2   1.4   28  225-252   111-138 (264)
212 cd05148 PTKc_Srm_Brk Catalytic  86.4    0.29 6.3E-06   41.3   0.8   28  225-252   109-136 (261)
213 cd05056 PTKc_FAK Catalytic dom  86.4     0.3 6.5E-06   41.7   0.9   29  224-252   111-139 (270)
214 cd06636 STKc_MAP4K4_6 Catalyti  86.4    0.36 7.7E-06   41.5   1.4   27  226-252   127-153 (282)
215 cd06608 STKc_myosinIII_like Ca  86.4    0.41 8.8E-06   40.3   1.7   29  224-252   117-145 (275)
216 cd07840 STKc_CDK9_like Catalyt  86.3    0.37 7.9E-06   40.9   1.4   32  221-252   101-132 (287)
217 cd07850 STKc_JNK Catalytic dom  86.3    0.34 7.5E-06   43.8   1.3   28  225-252   123-150 (353)
218 cd08229 STKc_Nek7 Catalytic do  86.3    0.37 8.1E-06   40.8   1.4   28  225-252   111-138 (267)
219 cd05047 PTKc_Tie Catalytic dom  86.3     0.3 6.4E-06   42.0   0.8   29  224-252   116-144 (270)
220 cd05050 PTKc_Musk Catalytic do  86.2    0.34 7.4E-06   41.9   1.2   29  224-252   134-162 (288)
221 cd07855 STKc_ERK5 Catalytic do  86.2    0.36 7.8E-06   43.3   1.3   29  224-252   111-139 (334)
222 cd05060 PTKc_Syk_like Catalyti  86.2    0.32 6.9E-06   41.2   0.9   30  224-253    99-128 (257)
223 cd06619 PKc_MKK5 Catalytic dom  86.2    0.36 7.8E-06   41.8   1.3   28  225-252   100-127 (279)
224 cd07865 STKc_CDK9 Catalytic do  86.1    0.36 7.8E-06   41.7   1.2   29  224-252   123-151 (310)
225 cd05097 PTKc_DDR_like Catalyti  86.1    0.36 7.9E-06   42.1   1.3   28  225-252   134-161 (295)
226 cd07845 STKc_CDK10 Catalytic d  86.0    0.37 8.1E-06   42.3   1.3   30  223-252   111-140 (309)
227 cd06652 STKc_MEKK2 Catalytic d  85.9     0.4 8.7E-06   40.8   1.4   29  224-252   110-138 (265)
228 cd05070 PTKc_Fyn_Yrk Catalytic  85.9    0.35 7.6E-06   41.1   1.0   28  225-252   107-134 (260)
229 cd05580 STKc_PKA Catalytic dom  85.8    0.39 8.4E-06   41.8   1.3   28  225-252   106-133 (290)
230 cd07866 STKc_BUR1 Catalytic do  85.8    0.39 8.5E-06   41.5   1.3   29  224-252   119-147 (311)
231 cd05069 PTKc_Yes Catalytic dom  85.8    0.35 7.6E-06   41.2   1.0   28  225-252   107-134 (260)
232 cd06638 STKc_myosinIIIA Cataly  85.7    0.41   9E-06   41.1   1.4   28  225-252   129-156 (286)
233 COG0515 SPS1 Serine/threonine   85.7    0.44 9.6E-06   38.3   1.5   32  222-253   103-134 (384)
234 cd06611 STKc_SLK_like Catalyti  85.6     0.4 8.8E-06   41.1   1.3   31  222-252   105-135 (280)
235 cd05079 PTKc_Jak1_rpt2 Catalyt  85.6    0.35 7.5E-06   41.9   0.9   29  224-252   113-141 (284)
236 cd05083 PTKc_Chk Catalytic dom  85.5    0.38 8.2E-06   40.7   1.1   28  225-252   105-132 (254)
237 cd07832 STKc_CCRK Catalytic do  85.4    0.41 8.9E-06   40.9   1.2   30  223-252   102-131 (286)
238 cd07836 STKc_Pho85 Catalytic d  85.4    0.41 8.9E-06   40.9   1.3   30  223-252   103-132 (284)
239 cd06649 PKc_MEK2 Catalytic dom  85.3    0.42 9.2E-06   43.0   1.3   28  225-252   108-136 (331)
240 PTZ00024 cyclin-dependent prot  85.3    0.42 9.1E-06   42.6   1.3   30  223-252   122-151 (335)
241 cd06651 STKc_MEKK3 Catalytic d  85.3    0.45 9.8E-06   40.6   1.5   29  224-252   110-138 (266)
242 cd08228 STKc_Nek6 Catalytic do  85.3    0.47   1E-05   40.2   1.5   29  224-252   110-138 (267)
243 cd05098 PTKc_FGFR1 Catalytic d  85.2    0.43 9.3E-06   42.0   1.3   28  225-252   145-172 (307)
244 cd05033 PTKc_EphR Catalytic do  85.2    0.37 8.1E-06   41.0   0.9   29  224-252   110-138 (266)
245 cd05065 PTKc_EphR_B Catalytic   85.2    0.39 8.4E-06   41.0   1.0   29  224-252   110-138 (269)
246 cd05114 PTKc_Tec_Rlk Catalytic  85.2    0.38 8.3E-06   40.7   1.0   28  225-252   105-132 (256)
247 cd05068 PTKc_Frk_like Catalyti  85.1     0.4 8.6E-06   40.7   1.0   29  224-252   107-135 (261)
248 cd06613 STKc_MAP4K3_like Catal  85.1    0.42   9E-06   40.2   1.1   29  224-252   105-133 (262)
249 cd07835 STKc_CDK1_like Catalyt  85.0    0.47   1E-05   40.7   1.5   30  223-252   102-131 (283)
250 cd05057 PTKc_EGFR_like Catalyt  85.0    0.37 8.1E-06   41.5   0.8   29  224-252   113-141 (279)
251 PLN00009 cyclin-dependent kina  85.0    0.41 8.9E-06   41.5   1.1   29  224-252   106-134 (294)
252 cd07831 STKc_MOK Catalytic dom  84.9    0.44 9.5E-06   40.6   1.2   28  225-252   105-132 (282)
253 cd05105 PTKc_PDGFR_alpha Catal  84.9    0.46 9.9E-06   45.2   1.4   29  224-252   241-269 (400)
254 smart00219 TyrKc Tyrosine kina  84.8    0.42 9.1E-06   39.8   1.0   30  223-252   106-135 (258)
255 PHA03390 pk1 serine/threonine-  84.8    0.47   1E-05   41.1   1.3   31  222-252   111-141 (267)
256 cd05577 STKc_GRK Catalytic dom  84.8    0.51 1.1E-05   40.7   1.6   28  225-252   100-127 (277)
257 cd06627 STKc_Cdc7_like Catalyt  84.7     0.5 1.1E-05   39.2   1.4   28  225-252   104-131 (254)
258 KOG0193 Serine/threonine prote  84.7    0.32   7E-06   50.7   0.4   27  226-252   494-520 (678)
259 cd08225 STKc_Nek5 Catalytic do  84.7    0.46   1E-05   39.8   1.2   29  224-252   105-133 (257)
260 cd05071 PTKc_Src Catalytic dom  84.6    0.46 9.9E-06   40.8   1.2   29  224-252   106-134 (262)
261 cd05072 PTKc_Lyn Catalytic dom  84.6    0.46   1E-05   40.2   1.2   28  225-252   108-135 (261)
262 cd06643 STKc_SLK Catalytic dom  84.6    0.44 9.6E-06   41.1   1.1   29  224-252   107-135 (282)
263 cd06654 STKc_PAK1 Catalytic do  84.5    0.51 1.1E-05   41.6   1.5   32  221-252   117-148 (296)
264 cd06648 STKc_PAK_II Catalytic   84.4    0.48   1E-05   41.4   1.3   28  225-252   120-147 (285)
265 cd05066 PTKc_EphR_A Catalytic   84.4     0.4 8.6E-06   41.0   0.7   29  224-252   110-138 (267)
266 cd08219 STKc_Nek3 Catalytic do  84.4    0.47   1E-05   40.0   1.2   29  224-252   104-132 (255)
267 cd07854 STKc_MAPK4_6 Catalytic  84.3    0.52 1.1E-05   42.6   1.5   30  223-252   117-146 (342)
268 cd07830 STKc_MAK_like Catalyti  84.2    0.53 1.1E-05   40.3   1.4   31  222-252   101-131 (283)
269 cd07856 STKc_Sty1_Hog1 Catalyt  84.2    0.54 1.2E-05   42.4   1.5   29  224-252   112-140 (328)
270 cd07834 STKc_MAPK Catalytic do  84.2    0.54 1.2E-05   41.6   1.5   28  225-252   108-135 (330)
271 KOG4645 MAPKKK (MAP kinase kin  83.9    0.49 1.1E-05   53.1   1.3   28  225-252  1339-1366(1509)
272 cd07860 STKc_CDK2_3 Catalytic   83.9    0.53 1.2E-05   40.4   1.3   29  224-252   104-132 (284)
273 cd05085 PTKc_Fer Catalytic dom  83.9    0.48   1E-05   39.8   1.0   28  225-252    98-125 (250)
274 cd06612 STKc_MST1_2 Catalytic   83.8     0.5 1.1E-05   39.5   1.1   29  224-252   103-131 (256)
275 cd07880 STKc_p38gamma_MAPK12 C  83.8    0.56 1.2E-05   42.5   1.5   29  224-252   122-150 (343)
276 cd05099 PTKc_FGFR4 Catalytic d  83.7    0.47   1E-05   42.1   0.9   27  226-252   140-166 (314)
277 cd07879 STKc_p38delta_MAPK13 C  83.7    0.58 1.3E-05   42.3   1.5   28  225-252   122-149 (342)
278 cd08217 STKc_Nek2 Catalytic do  83.6    0.59 1.3E-05   38.9   1.4   30  223-252   108-142 (265)
279 PF14812 PBP1_TM:  Transmembran  83.6    0.35 7.5E-06   38.4   0.0    9  132-140    49-57  (81)
280 KOG1164 Casein kinase (serine/  83.6    0.56 1.2E-05   42.9   1.3   25  228-252   130-154 (322)
281 cd07852 STKc_MAPK15 Catalytic   83.5    0.51 1.1E-05   42.2   1.1   28  225-252   112-139 (337)
282 cd07858 STKc_TEY_MAPK_plant Ca  83.4     0.6 1.3E-05   42.0   1.5   30  223-252   111-140 (337)
283 cd06628 STKc_MAPKKK_Byr2_like   83.4    0.62 1.3E-05   39.5   1.5   29  224-252   110-138 (267)
284 cd08221 STKc_Nek9 Catalytic do  83.4     0.6 1.3E-05   39.3   1.4   29  224-252   105-133 (256)
285 cd05572 STKc_cGK_PKG Catalytic  83.4    0.61 1.3E-05   39.5   1.4   28  225-252    98-125 (262)
286 cd06617 PKc_MKK3_6 Catalytic d  83.3    0.63 1.4E-05   39.8   1.5   29  224-252   107-136 (283)
287 cd05087 PTKc_Aatyk1_Aatyk3 Cat  83.1    0.53 1.2E-05   40.3   1.0   28  225-252   105-132 (269)
288 PTZ00415 transmission-blocking  83.0     0.6 1.3E-05   53.8   1.5   15  126-140   171-185 (2849)
289 cd06626 STKc_MEKK4 Catalytic d  83.0    0.63 1.4E-05   39.1   1.4   28  225-252   104-131 (264)
290 cd06639 STKc_myosinIIIB Cataly  83.0     0.6 1.3E-05   40.4   1.3   28  225-252   133-160 (291)
291 cd05112 PTKc_Itk Catalytic dom  82.9    0.58 1.3E-05   39.4   1.1   29  224-252   104-132 (256)
292 cd07877 STKc_p38alpha_MAPK14 C  82.9    0.58 1.3E-05   42.4   1.2   28  225-252   125-152 (345)
293 cd05034 PTKc_Src_like Catalyti  82.9    0.61 1.3E-05   39.4   1.2   29  224-252   107-135 (261)
294 cd05107 PTKc_PDGFR_beta Cataly  82.8     0.6 1.3E-05   44.5   1.3   28  225-252   244-271 (401)
295 cd06917 STKc_NAK1_like Catalyt  82.7    0.66 1.4E-05   39.6   1.4   28  225-252   106-133 (277)
296 cd05578 STKc_Yank1 Catalytic d  82.6    0.66 1.4E-05   39.2   1.3   29  224-252   104-132 (258)
297 cd07846 STKc_CDKL2_3 Catalytic  82.6    0.64 1.4E-05   39.8   1.3   29  224-252   104-132 (286)
298 cd06632 STKc_MEKK1_plant Catal  82.6    0.66 1.4E-05   38.7   1.3   28  225-252   107-134 (258)
299 KOG4721 Serine/threonine prote  82.5    0.37 8.1E-06   50.7  -0.2   30  223-252   215-244 (904)
300 cd08224 STKc_Nek6_Nek7 Catalyt  82.4    0.67 1.5E-05   39.0   1.3   29  224-252   110-138 (267)
301 PRK01723 3-deoxy-D-manno-octul  82.4    0.66 1.4E-05   41.4   1.3   28  225-252   147-174 (239)
302 cd07838 STKc_CDK4_6_like Catal  82.3    0.66 1.4E-05   39.5   1.2   30  223-252   110-139 (287)
303 cd07829 STKc_CDK_like Catalyti  82.3    0.64 1.4E-05   39.5   1.1   29  224-252   102-130 (282)
304 cd06622 PKc_MAPKK_PBS2_like Ca  82.2    0.61 1.3E-05   40.2   1.0   29  224-252   106-135 (286)
305 cd05122 PKc_STE Catalytic doma  82.1    0.75 1.6E-05   37.7   1.4   28  225-252   103-130 (253)
306 cd05073 PTKc_Hck Catalytic dom  82.0    0.63 1.4E-05   39.6   1.0   29  224-252   106-134 (260)
307 cd05063 PTKc_EphR_A2 Catalytic  82.0    0.58 1.3E-05   39.8   0.8   30  223-252   110-139 (268)
308 cd07864 STKc_CDK12 Catalytic d  81.9    0.71 1.5E-05   40.0   1.3   31  222-252   118-148 (302)
309 cd05609 STKc_MAST Catalytic do  81.9     0.7 1.5E-05   40.6   1.3   27  226-252   107-133 (305)
310 cd06631 STKc_YSK4 Catalytic do  81.8    0.73 1.6E-05   39.1   1.3   30  224-253   106-135 (265)
311 cd06635 STKc_TAO1 Catalytic do  81.6    0.69 1.5E-05   41.1   1.2   28  225-252   130-157 (317)
312 cd06607 STKc_TAO Catalytic dom  81.6    0.68 1.5E-05   40.8   1.1   29  224-252   119-147 (307)
313 cd06657 STKc_PAK4 Catalytic do  81.5    0.75 1.6E-05   40.6   1.4   29  224-252   120-148 (292)
314 cd05574 STKc_phototropin_like   81.5    0.69 1.5E-05   40.7   1.1   27  226-252   109-135 (316)
315 cd06609 STKc_MST3_like Catalyt  81.3    0.81 1.8E-05   39.1   1.5   30  223-252   101-130 (274)
316 cd05144 RIO2_C RIO kinase fami  81.1    0.77 1.7E-05   38.6   1.2   31  222-252   127-157 (198)
317 cd06629 STKc_MAPKKK_Bck1_like   81.1    0.79 1.7E-05   39.1   1.3   27  226-252   114-140 (272)
318 cd06656 STKc_PAK3 Catalytic do  80.9    0.82 1.8E-05   40.3   1.4   30  223-252   118-147 (297)
319 PTZ00415 transmission-blocking  80.9    0.85 1.8E-05   52.6   1.7    6   48-53     95-100 (2849)
320 KOG0593 Predicted protein kina  80.7     0.8 1.7E-05   45.0   1.3   29  224-252   105-133 (396)
321 KOG0583 Serine/threonine prote  80.5     0.8 1.7E-05   43.9   1.2   26  227-252   127-152 (370)
322 cd05613 STKc_MSK1_N N-terminal  80.4    0.83 1.8E-05   39.6   1.2   27  227-253   112-138 (290)
323 cd06610 STKc_OSR1_SPAK Catalyt  80.3    0.86 1.9E-05   38.2   1.3   29  224-252   106-134 (267)
324 KOG1832 HIV-1 Vpr-binding prot  80.3     0.8 1.7E-05   50.1   1.3   14   41-54   1358-1371(1516)
325 cd07833 STKc_CDKL Catalytic do  80.1    0.91   2E-05   38.8   1.3   29  224-252   104-132 (288)
326 KOG0595 Serine/threonine-prote  79.9     0.8 1.7E-05   45.8   1.1   29  224-252   113-141 (429)
327 TIGR03724 arch_bud32 Kae1-asso  79.8    0.87 1.9E-05   37.7   1.1   29  224-252    94-122 (199)
328 cd06606 STKc_MAPKKK Catalytic   79.7    0.98 2.1E-05   37.2   1.4   30  223-252   104-133 (260)
329 KOG0663 Protein kinase PITSLRE  79.6    0.85 1.8E-05   45.2   1.1   34  219-252   176-209 (419)
330 smart00090 RIO RIO-like kinase  79.5    0.95   2E-05   40.4   1.3   30  223-252   151-181 (237)
331 cd06644 STKc_STK10_LOK Catalyt  79.3    0.87 1.9E-05   39.6   1.0   30  223-252   113-142 (292)
332 PRK12274 serine/threonine prot  79.3    0.87 1.9E-05   41.6   1.0   28  225-252    96-124 (218)
333 PLN03224 probable serine/threo  79.1    0.93   2E-05   45.6   1.3   28  225-252   314-341 (507)
334 KOG0584 Serine/threonine prote  79.1     0.9   2E-05   47.3   1.2   30  223-252   146-177 (632)
335 cd06655 STKc_PAK2 Catalytic do  79.0       1 2.3E-05   39.7   1.4   30  223-252   118-147 (296)
336 PRK09605 bifunctional UGMP fam  79.0    0.99 2.1E-05   44.6   1.4   28  225-252   433-460 (535)
337 cd06634 STKc_TAO2 Catalytic do  78.8       1 2.3E-05   39.8   1.3   28  225-252   120-147 (308)
338 cd06650 PKc_MEK1 Catalytic dom  78.7       1 2.2E-05   40.7   1.3   30  224-253   107-137 (333)
339 cd07851 STKc_p38 Catalytic dom  78.7     1.1 2.4E-05   40.5   1.5   30  223-252   121-150 (343)
340 cd08222 STKc_Nek11 Catalytic d  78.6     1.1 2.4E-05   37.9   1.4   30  223-252   109-138 (260)
341 cd06633 STKc_TAO3 Catalytic do  78.5       1 2.3E-05   40.0   1.2   28  225-252   126-153 (313)
342 KOG0669 Cyclin T-dependent kin  78.4    0.69 1.5E-05   44.7   0.1   31  227-257   131-165 (376)
343 cd08530 STKc_CNK2-like Catalyt  78.3     1.1 2.3E-05   37.4   1.2   29  224-252   107-135 (256)
344 cd05583 STKc_MSK_N N-terminal   78.2     1.1 2.4E-05   38.7   1.3   27  226-252   111-137 (288)
345 PF07714 Pkinase_Tyr:  Protein   78.1     1.1 2.4E-05   38.7   1.2   30  223-252   106-135 (259)
346 KOG0603 Ribosomal protein S6 k  78.0    0.44 9.5E-06   49.5  -1.4   28  226-253   421-448 (612)
347 cd06605 PKc_MAPKK Catalytic do  78.0     1.3 2.8E-05   37.3   1.7   28  225-252   105-133 (265)
348 PRK14879 serine/threonine prot  78.0     1.1 2.4E-05   37.3   1.2   28  225-252   100-127 (211)
349 cd08215 STKc_Nek Catalytic dom  77.8     1.2 2.5E-05   36.9   1.3   30  223-252   106-135 (258)
350 cd06640 STKc_MST4 Catalytic do  77.8     1.2 2.7E-05   38.3   1.5   30  223-252   104-133 (277)
351 cd06642 STKc_STK25-YSK1 Cataly  77.7     1.1 2.5E-05   38.4   1.3   29  224-252   105-133 (277)
352 KOG0580 Serine/threonine prote  77.7     1.5 3.2E-05   41.7   2.0   32  224-255   128-159 (281)
353 PRK13184 pknD serine/threonine  77.6    0.98 2.1E-05   48.9   1.0   28  225-252   118-145 (932)
354 cd05119 RIO RIO kinase family,  77.6     1.3 2.8E-05   36.2   1.4   33  220-252   114-147 (187)
355 KOG0576 Mitogen-activated prot  77.4    0.81 1.8E-05   48.6   0.3   26  227-252   119-144 (829)
356 cd06616 PKc_MKK4 Catalytic dom  77.4     1.1 2.4E-05   38.6   1.1   29  224-252   111-140 (288)
357 KOG0984 Mitogen-activated prot  77.2    0.79 1.7E-05   43.2   0.1   26  227-252   155-181 (282)
358 KOG1832 HIV-1 Vpr-binding prot  77.1     1.5 3.3E-05   48.1   2.2    6   97-102  1404-1409(1516)
359 cd06623 PKc_MAPKK_plant_like C  77.1     1.3 2.9E-05   37.0   1.4   29  224-252   103-132 (264)
360 KOG0667 Dual-specificity tyros  77.0     1.2 2.6E-05   46.2   1.3   29  224-252   293-321 (586)
361 cd06615 PKc_MEK Catalytic doma  77.0     1.2 2.6E-05   39.5   1.2   29  224-252   103-132 (308)
362 KOG0582 Ste20-like serine/thre  76.8     1.1 2.4E-05   45.6   1.0   26  227-252   133-158 (516)
363 cd05581 STKc_PDK1 Catalytic do  76.3     1.4 3.1E-05   37.2   1.4   30  223-252   105-134 (280)
364 cd08218 STKc_Nek1 Catalytic do  76.0     1.3 2.8E-05   37.3   1.1   28  225-252   106-133 (256)
365 cd00180 PKc Catalytic domain o  76.0     1.4 3.1E-05   34.2   1.3   29  224-252    96-124 (215)
366 cd06621 PKc_MAPKK_Pek1_like Ca  75.7     1.5 3.2E-05   38.2   1.4   28  225-252   110-137 (287)
367 cd05123 STKc_AGC Catalytic dom  75.3     1.3 2.9E-05   36.8   1.0   29  224-252    97-125 (250)
368 KOG1167 Serine/threonine prote  75.3     1.5 3.3E-05   43.7   1.5   30  224-253   136-165 (418)
369 KOG0197 Tyrosine kinases [Sign  74.2     1.4 3.1E-05   44.5   1.1   42  217-258   300-345 (468)
370 KOG0599 Phosphorylase kinase g  73.9     1.4 3.1E-05   43.0   0.9   31  224-254   127-157 (411)
371 cd06618 PKc_MKK7 Catalytic dom  73.9     1.6 3.5E-05   38.1   1.2   29  224-252   118-147 (296)
372 cd06614 STKc_PAK Catalytic dom  73.8     1.6 3.5E-05   37.7   1.1   32  221-252   117-148 (286)
373 KOG0032 Ca2+/calmodulin-depend  73.7     1.7 3.8E-05   42.0   1.5   35  219-253   134-168 (382)
374 KOG0589 Serine/threonine prote  73.7     1.7 3.7E-05   43.4   1.4   28  225-252   111-138 (426)
375 PF03153 TFIIA:  Transcription   73.4     1.3 2.9E-05   41.9   0.6    7  130-136   329-335 (375)
376 KOG0616 cAMP-dependent protein  72.9     1.9 4.1E-05   42.2   1.4   27  226-252   150-176 (355)
377 KOG0194 Protein tyrosine kinas  72.7     1.7 3.7E-05   43.9   1.1   29  224-252   266-294 (474)
378 cd06647 STKc_PAK_I Catalytic d  72.6     1.8 3.9E-05   38.0   1.2   29  224-252   119-147 (293)
379 cd08528 STKc_Nek10 Catalytic d  72.4     1.9 4.1E-05   36.7   1.2   28  225-252   118-146 (269)
380 KOG2345 Serine/threonine prote  71.8     1.7 3.7E-05   41.6   0.9   25  228-252   135-161 (302)
381 KOG0607 MAP kinase-interacting  71.7     1.2 2.6E-05   44.3  -0.2   27  227-253   183-209 (463)
382 cd06641 STKc_MST3 Catalytic do  71.3     2.3 4.9E-05   36.7   1.5   30  223-252   104-133 (277)
383 PTZ00266 NIMA-related protein   71.1     2.1 4.6E-05   46.9   1.5   28  225-252   123-157 (1021)
384 KOG0665 Jun-N-terminal kinase   70.6     1.9 4.1E-05   42.4   0.9   29  224-252   122-150 (369)
385 smart00220 S_TKc Serine/Threon  70.6     2.3   5E-05   34.4   1.3   30  223-252    90-119 (244)
386 PLN02400 cellulose synthase     70.3     4.4 9.6E-05   44.8   3.6   30   45-74     38-71  (1085)
387 KOG0591 NIMA (never in mitosis  69.6     2.3   5E-05   41.6   1.2   26  227-252   131-160 (375)
388 PLN02189 cellulose synthase     69.1     5.2 0.00011   44.1   3.9   30   45-74     36-69  (1040)
389 PF04147 Nop14:  Nop14-like fam  68.8       4 8.7E-05   43.6   2.9    7  167-173   446-452 (840)
390 PRK10359 lipopolysaccharide co  67.1     2.8   6E-05   38.4   1.2   27  226-252   141-167 (232)
391 PF03115 Astro_capsid:  Astrovi  66.8     1.9   4E-05   46.2   0.0    6  133-138   719-724 (787)
392 PHA02988 hypothetical protein;  66.0       3 6.6E-05   36.7   1.2   30  223-252   125-155 (283)
393 KOG3540 Beta amyloid precursor  65.9     5.1 0.00011   41.3   2.9   11   46-56    143-153 (615)
394 KOG0986 G protein-coupled rece  63.9     3.4 7.4E-05   42.5   1.2   29  224-252   291-319 (591)
395 KOG0661 MAPK related serine/th  62.6       2 4.3E-05   44.0  -0.7   26  227-252   117-142 (538)
396 KOG0033 Ca2+/calmodulin-depend  62.1     4.3 9.4E-05   39.2   1.5   28  225-252   115-142 (355)
397 PF04889 Cwf_Cwc_15:  Cwf15/Cwc  61.5     5.1 0.00011   37.1   1.8   11  165-175   197-208 (244)
398 cd06620 PKc_MAPKK_Byr1_like Ca  61.1     4.4 9.6E-05   35.0   1.3   29  224-252   107-136 (284)
399 KOG0983 Mitogen-activated prot  60.9     3.9 8.4E-05   40.1   1.0   27  226-252   197-224 (391)
400 smart00221 STYKc Protein kinas  60.8     4.9 0.00011   32.4   1.4   31  222-252   100-130 (225)
401 KOG1166 Mitotic checkpoint ser  60.0     4.3 9.3E-05   44.5   1.2   37  216-252   790-826 (974)
402 KOG0577 Serine/threonine prote  59.7     3.3 7.1E-05   44.1   0.3   30  228-257   134-167 (948)
403 KOG1027 Serine/threonine prote  59.6     3.8 8.3E-05   44.4   0.7   31  223-253   609-639 (903)
404 PLN00113 leucine-rich repeat r  59.2     5.2 0.00011   41.6   1.6   28  225-252   785-815 (968)
405 KOG4250 TANK binding protein k  58.0     4.7  0.0001   42.9   1.1   36  217-252   113-152 (732)
406 PLN02436 cellulose synthase A   57.9      11 0.00024   41.9   3.8   30   45-74     38-71  (1094)
407 KOG3130 Uncharacterized conser  56.9     8.7 0.00019   38.9   2.7    7  167-173   339-345 (514)
408 KOG1006 Mitogen-activated prot  56.3       3 6.6E-05   40.6  -0.6   26  227-252   174-200 (361)
409 KOG1152 Signal transduction se  56.1     4.8  0.0001   42.6   0.8   32  220-251   670-701 (772)
410 KOG0699 Serine/threonine prote  56.1     7.5 0.00016   39.2   2.1   22  117-138   295-316 (542)
411 cd05151 ChoK Choline Kinase (C  55.1     6.8 0.00015   31.2   1.3   28  225-252    88-120 (170)
412 cd05120 APH_ChoK_like Aminogly  54.9     6.3 0.00014   29.4   1.1   29  224-252    90-121 (155)
413 PRK14559 putative protein seri  54.7      11 0.00024   39.5   3.2   51    1-68      1-51  (645)
414 KOG3130 Uncharacterized conser  53.9     7.3 0.00016   39.4   1.6    6  133-138   304-309 (514)
415 PF03153 TFIIA:  Transcription   52.8     4.6 9.9E-05   38.4   0.0    7   96-102   273-279 (375)
416 KOG1999 RNA polymerase II tran  51.9      11 0.00023   41.6   2.6   12  205-216   162-173 (1024)
417 PTZ00007 (NAP-L) nucleosome as  50.0      14  0.0003   36.0   2.8   13   85-97    271-283 (337)
418 KOG2140 Uncharacterized conser  48.8      12 0.00027   39.2   2.4   26  115-140   423-448 (739)
419 KOG3241 Uncharacterized conser  48.0      14 0.00031   33.8   2.4   10   46-55     45-54  (227)
420 PF04546 Sigma70_ner:  Sigma-70  47.3      10 0.00023   33.5   1.4    7  249-255   148-154 (211)
421 PF12773 DZR:  Double zinc ribb  46.8      23 0.00049   24.2   2.7   40   18-64     10-49  (50)
422 KOG1345 Serine/threonine kinas  45.9     9.3  0.0002   37.4   0.9   27  226-252   127-153 (378)
423 KOG0605 NDR and related serine  45.6      11 0.00024   39.1   1.4   27  226-252   247-273 (550)
424 KOG4236 Serine/threonine prote  45.5      11 0.00023   40.1   1.3   26  227-252   671-696 (888)
425 KOG3540 Beta amyloid precursor  44.7      16 0.00035   37.8   2.4   11   83-93    180-190 (615)
426 KOG0586 Serine/threonine prote  44.0      12 0.00027   39.1   1.5   27  226-252   161-187 (596)
427 KOG1163 Casein kinase (serine/  43.7      11 0.00024   36.5   1.0   26  227-252   118-143 (341)
428 PF06293 Kdo:  Lipopolysacchari  43.2      12 0.00027   32.3   1.2   30  223-252   121-150 (206)
429 PF14569 zf-UDP:  Zinc-binding   42.6      23 0.00049   28.3   2.4   36   39-74      5-44  (80)
430 KOG0200 Fibroblast/platelet-de  41.5      13 0.00027   38.0   1.1   32  221-252   419-450 (609)
431 KOG1290 Serine/threonine prote  41.0      13 0.00027   38.7   1.0   27  226-252   193-220 (590)
432 cd05146 RIO3_euk RIO kinase fa  40.6      15 0.00032   32.7   1.3   27  226-252   130-157 (197)
433 KOG1991 Nuclear transport rece  39.8      18  0.0004   39.9   2.0   43   88-130   892-952 (1010)
434 PTZ00429 beta-adaptin; Provisi  39.2      21 0.00045   38.1   2.3   17  126-142   613-629 (746)
435 KOG0610 Putative serine/threon  38.5      12 0.00025   38.1   0.3   27  226-252   185-211 (459)
436 KOG3241 Uncharacterized conser  38.4      23  0.0005   32.5   2.2    8   20-27     93-100 (227)
437 KOG0574 STE20-like serine/thre  38.1       9 0.00019   38.1  -0.5   30  229-258   138-171 (502)
438 KOG1151 Tousled-like protein k  38.0     9.5 0.00021   39.7  -0.4   35  218-252   566-602 (775)
439 KOG1980 Uncharacterized conser  36.1      17 0.00037   38.7   1.1   20   79-99    360-379 (754)
440 KOG0668 Casein kinase II, alph  35.8      20 0.00044   34.5   1.5   28  225-252   137-164 (338)
441 KOG0597 Serine-threonine prote  35.6      17 0.00038   38.6   1.1   27  226-252   106-132 (808)
442 KOG0772 Uncharacterized conser  34.7      31 0.00067   36.1   2.6    7  134-140   153-159 (641)
443 KOG0587 Traf2- and Nck-interac  34.6      17 0.00036   39.9   0.8   26  227-252   130-155 (953)
444 PF03660 PHF5:  PHF5-like prote  34.6      17 0.00038   30.3   0.7   52   20-74     20-78  (106)
445 PRK15123 lipopolysaccharide co  34.2      21 0.00046   32.9   1.3   26  227-252   145-170 (268)
446 KOG4158 BRPK/PTEN-induced prot  34.1      17 0.00038   37.3   0.8   26  227-252   348-373 (598)
447 KOG0671 LAMMER dual specificit  33.5      20 0.00044   36.0   1.1   27  226-252   198-224 (415)
448 PF14531 Kinase-like:  Kinase-l  32.9      22 0.00048   33.7   1.2   28  225-252   150-177 (288)
449 KOG2038 CAATT-binding transcri  32.8      24 0.00052   38.5   1.5   11   13-23    697-707 (988)
450 PF05764 YL1:  YL1 nuclear prot  32.6      42 0.00091   30.7   2.9    6  225-230   145-150 (240)
451 KOG0262 RNA polymerase I, larg  32.6      45 0.00097   38.3   3.6  104   80-184  1320-1440(1640)
452 PRK14873 primosome assembly pr  32.4      31 0.00067   36.2   2.3   38   10-52    381-419 (665)
453 PLN02638 cellulose synthase A   31.6      46 0.00099   37.3   3.4   36   39-74     13-52  (1079)
454 KOG2807 RNA polymerase II tran  31.4      23 0.00049   35.1   1.1   67   10-76    274-364 (378)
455 cd02335 ZZ_ADA2 Zinc finger, Z  31.4      50  0.0011   23.1   2.5   32   45-76      2-34  (49)
456 cd02340 ZZ_NBR1_like Zinc fing  31.4      43 0.00093   23.1   2.2   31   45-76      2-33  (43)
457 KOG0604 MAP kinase-activated p  30.9      26 0.00056   34.8   1.3   26  227-252   168-193 (400)
458 PF09073 BUD22:  BUD22;  InterP  30.1      72  0.0016   31.5   4.3   71   93-163   177-259 (432)
459 cd02341 ZZ_ZZZ3 Zinc finger, Z  29.9      47   0.001   23.6   2.2   41   46-86      3-48  (48)
460 cd02249 ZZ Zinc finger, ZZ typ  29.9      51  0.0011   22.5   2.3   44   44-89      1-46  (46)
461 KOG1834 Calsyntenin [Extracell  29.7      32  0.0007   37.1   1.9   40   98-137   892-931 (952)
462 PF04438 zf-HIT:  HIT zinc fing  29.1      23 0.00049   23.0   0.4   24   42-69      1-24  (30)
463 KOG0127 Nucleolar protein fibr  28.9      27 0.00059   36.7   1.2   32  101-132   215-246 (678)
464 KOG4672 Uncharacterized conser  28.8      92   0.002   31.9   4.7   68   88-155   231-314 (487)
465 KOG2141 Protein involved in hi  28.7      50  0.0011   35.7   3.1   75   98-172   237-320 (822)
466 KOG4364 Chromatin assembly fac  28.7      53  0.0012   35.3   3.2   55   82-137   507-561 (811)
467 KOG1025 Epidermal growth facto  28.5      26 0.00057   38.8   1.0   27  226-252   804-830 (1177)
468 KOG1824 TATA-binding protein-i  28.1      26 0.00057   39.0   0.9   26  101-126   316-343 (1233)
469 KOG0590 Checkpoint kinase and   27.7      25 0.00054   36.3   0.7   25  228-252   428-452 (601)
470 PF09538 FYDLN_acid:  Protein o  27.6 1.1E+02  0.0024   25.2   4.3   83   47-132    10-93  (108)
471 PF15449 Retinal:  Retinal prot  27.0      61  0.0013   36.6   3.4   58  110-173   483-540 (1287)
472 PHA02811 putative host range p  26.9      39 0.00085   30.9   1.7   29  101-129   169-197 (197)
473 KOG2652 RNA polymerase II tran  26.4      49  0.0011   32.7   2.4   42   91-132   255-298 (348)
474 KOG0127 Nucleolar protein fibr  26.3      36 0.00078   35.9   1.5   40   96-135   224-265 (678)
475 PF12253 CAF1A:  Chromatin asse  26.1      77  0.0017   24.8   3.0   47   83-129    29-76  (77)
476 PF07975 C1_4:  TFIIH C1-like d  25.9      37 0.00079   24.8   1.1   31   46-76      2-40  (51)
477 KOG2652 RNA polymerase II tran  25.4      64  0.0014   31.9   2.9   51   86-136   253-308 (348)
478 PF15243 ANAPC15:  Anaphase-pro  25.2      41 0.00088   27.3   1.3   28  105-132    63-90  (92)
479 PF14951 DUF4503:  Domain of un  25.0      52  0.0011   32.9   2.2   54    2-59    275-329 (389)
480 TIGR00595 priA primosomal prot  24.9      55  0.0012   33.0   2.5   47   12-65    213-260 (505)
481 PF05320 Pox_RNA_Pol_19:  Poxvi  24.9      21 0.00044   31.9  -0.4   30  103-132     2-31  (167)
482 KOG0262 RNA polymerase I, larg  24.3      65  0.0014   37.1   3.1   52   84-135  1316-1385(1640)
483 KOG4257 Focal adhesion tyrosin  24.2      30 0.00065   37.4   0.5   25  228-252   499-523 (974)
484 KOG0694 Serine/threonine prote  24.2      36 0.00079   36.3   1.1   27  226-252   474-500 (694)
485 KOG1240 Protein kinase contain  24.0      34 0.00073   39.0   0.8   25  228-252   128-152 (1431)
486 KOG1834 Calsyntenin [Extracell  23.9      52  0.0011   35.6   2.2   44   85-129   883-926 (952)
487 PF03896 TRAP_alpha:  Transloco  23.7      63  0.0014   30.8   2.5   50  105-154    33-82  (285)
488 KOG2141 Protein involved in hi  23.6      76  0.0016   34.5   3.3   63   91-153   222-286 (822)
489 smart00750 KIND kinase non-cat  23.4      42 0.00091   26.8   1.1   37  227-263    24-64  (176)
490 KOG2773 Apoptosis antagonizing  22.9      47   0.001   34.0   1.6   38   96-133    79-116 (483)
491 KOG1991 Nuclear transport rece  22.8      50  0.0011   36.7   1.8   43   89-131   888-950 (1010)
492 PLN02915 cellulose synthase A   22.8      71  0.0015   35.8   3.0   71   45-118    17-92  (1044)
493 KOG1989 ARK protein kinase fam  22.7      41 0.00088   36.2   1.2   26  227-252   151-178 (738)
494 KOG3653 Transforming growth fa  22.5      40 0.00086   35.0   1.0   24  229-252   316-348 (534)
495 KOG2023 Nuclear transport rece  22.4      45 0.00098   36.1   1.4   20   98-117   345-364 (885)
496 KOG0614 cGMP-dependent protein  22.4      40 0.00086   35.7   1.0   24  229-252   529-552 (732)
497 cd02342 ZZ_UBA_plant Zinc fing  22.3      58  0.0013   23.2   1.5   24    3-26      2-30  (43)
498 PHA03346 US22 family homolog;   22.3      77  0.0017   32.8   3.0   49   90-138   395-461 (520)
499 PF01056 Myc_N:  Myc amino-term  22.1      30 0.00064   33.7   0.0   27  110-136   221-247 (329)
500 KOG2675 Adenylate cyclase-asso  22.0      79  0.0017   32.4   2.9   33  136-168   228-267 (480)

No 1  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=97.38  E-value=0.00013  Score=47.35  Aligned_cols=38  Identities=45%  Similarity=0.840  Sum_probs=33.2

Q ss_pred             CCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            2 RKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         2 ~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ..|..++. ++.+||..|++.+|..|+...|.      .|.+++|
T Consensus         1 ~~C~~H~~~~~~~fC~~~~~~iC~~C~~~~H~------~H~~~~i   39 (39)
T cd00021           1 RLCDEHGEEPLSLFCETDRALLCVDCDLSVHS------GHRRVPL   39 (39)
T ss_pred             CCCCccCCcceEEEeCccChhhhhhcChhhcC------CCCEeeC
Confidence            36899988 99999999999999999988875      5888775


No 2  
>smart00336 BBOX B-Box-type zinc finger.
Probab=96.77  E-value=0.0012  Score=43.29  Aligned_cols=39  Identities=41%  Similarity=0.698  Sum_probs=32.6

Q ss_pred             CCCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            1 MRKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         1 m~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ++.|..+.. ++.+||..+.+.+|..|....|      +.|.+++|
T Consensus         3 ~~~C~~h~~~~~~~~C~~c~~~iC~~C~~~~H------~~H~~~~l   42 (42)
T smart00336        3 PPKCDSHGDEPAEFFCEECGALLCRTCDEAEH------RGHTVVLL   42 (42)
T ss_pred             CCcCCCCCCCceEEECCCCCcccccccChhhc------CCCceecC
Confidence            367999996 9999999999999999998866      35777664


No 3  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.47  E-value=0.0014  Score=43.78  Aligned_cols=39  Identities=26%  Similarity=0.499  Sum_probs=33.2

Q ss_pred             CCCCCCCCC-CceEEecCCCcccccccCcccccccccCCccccccc
Q 024658            1 MRKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLL   45 (264)
Q Consensus         1 m~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (264)
                      ++.|..+.. ++.+||..+...||..|....|..      |..++|
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~------H~~~~i   42 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG------HKIVPI   42 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT------SEEEEC
T ss_pred             CccCccCCccceEEEecCCCCccCccCCCCCCCC------CEEeEC
Confidence            578999999 699999999999999999999865      777664


No 4  
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=96.28  E-value=0.0034  Score=59.27  Aligned_cols=12  Identities=75%  Similarity=1.249  Sum_probs=4.7

Q ss_pred             CCCCCCCCCCCC
Q 024658          111 DEDDDDDDDEDP  122 (264)
Q Consensus       111 ded~~~dd~e~e  122 (264)
                      |+|+|||+||++
T Consensus       279 d~d~d~d~eed~  290 (314)
T PF06524_consen  279 DEDDDEDDEEDE  290 (314)
T ss_pred             cccccccccccc
Confidence            344444443333


No 5  
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=96.24  E-value=0.0012  Score=66.17  Aligned_cols=74  Identities=26%  Similarity=0.385  Sum_probs=64.3

Q ss_pred             CCCCCCC---CceEEecCCCcccccccCcccccccccCCcccccccc-------------cccccCCCCceecccCCCCc
Q 024658            3 KCELCEC---PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLC-------------HVCQSLTPWKASGPKLGPTV   66 (264)
Q Consensus         3 ~Cd~C~~---pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC-------------~~C~~~p~~ka~~~C~~d~~   66 (264)
                      .|.+|++   .|.|+|+....+.|.-|..+.|-+--.+++|.-+|-.             ..|-.|+...-.+||..|.+
T Consensus       164 kcqlce~a~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grvs~~~s~r~~~~ct~h~~e~~smyc~~ck~  243 (699)
T KOG4367|consen  164 KCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKM  243 (699)
T ss_pred             hhhhhcCChhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCceeeccchhhhhhccCCCCCCceEEEEecCC
Confidence            6999998   4999999999999999999999877778888655542             47888998889999999999


Q ss_pred             ccCchhhhcc
Q 024658           67 SVCDACVAAA   76 (264)
Q Consensus        67 ~LC~~Cd~~~   76 (264)
                      ++|-.|--.+
T Consensus       244 pvc~~clee~  253 (699)
T KOG4367|consen  244 PVCYQCLEEG  253 (699)
T ss_pred             hHHHHHHHhh
Confidence            9999998754


No 6  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=96.18  E-value=0.0027  Score=41.11  Aligned_cols=37  Identities=11%  Similarity=-0.017  Sum_probs=28.7

Q ss_pred             cccCCCCceecccCCCCcccCchhhhcccCCCCCCccc
Q 024658           49 CQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDKA   86 (264)
Q Consensus        49 C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV   86 (264)
                      |+.|+...+.+||..|.+.||..|...+ -.+|.++||
T Consensus         3 C~~H~~~~~~~fC~~~~~~iC~~C~~~~-H~~H~~~~i   39 (39)
T cd00021           3 CDEHGEEPLSLFCETDRALLCVDCDLSV-HSGHRRVPL   39 (39)
T ss_pred             CCccCCcceEEEeCccChhhhhhcChhh-cCCCCEeeC
Confidence            5555544589999999999999999865 357777664


No 7  
>KOG0585 consensus Ca2+/calmodulin-dependent protein kinase kinase beta and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=96.15  E-value=0.002  Score=65.19  Aligned_cols=51  Identities=14%  Similarity=0.087  Sum_probs=35.0

Q ss_pred             ccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          200 SSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       200 ~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+.++++.-+.  ..+++.-.++-.--+.+|.+|.|||.|.|||||+|++|+|
T Consensus       192 ~s~G~v~w~p~--d~~els~~~Ar~ylrDvv~GLEYLH~QgiiHRDIKPsNLL  242 (576)
T KOG0585|consen  192 CSKGEVKWCPP--DKPELSEQQARKYLRDVVLGLEYLHYQGIIHRDIKPSNLL  242 (576)
T ss_pred             ccCCccccCCC--CcccccHHHHHHHHHHHHHHHHHHHhcCeeccccchhheE
Confidence            34567666553  2222222233334467888999999999999999999986


No 8  
>KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=95.91  E-value=0.003  Score=59.80  Aligned_cols=29  Identities=17%  Similarity=0.162  Sum_probs=27.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+++|+++|+|||++.|+|+|+|+||||
T Consensus       121 ~ytr~iL~GL~ylHs~g~vH~DiK~~NiL  149 (313)
T KOG0198|consen  121 RYTRQILEGLAYLHSKGIVHCDIKPANIL  149 (313)
T ss_pred             HHHHHHHHHHHHHHhCCEeccCcccceEE
Confidence            45689999999999999999999999997


No 9  
>KOG4279 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=95.64  E-value=0.0028  Score=67.00  Aligned_cols=50  Identities=20%  Similarity=0.379  Sum_probs=39.6

Q ss_pred             ccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH-----hhhhccc
Q 024658          200 SSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT-----GICRLSR  259 (264)
Q Consensus       200 ~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~-----~ic~l~~  259 (264)
                      +-.+|||+---+++=          -+.+|+++|+|||.+.|.|||+|+-|+|     |+||+|-
T Consensus       665 skWGPlKDNEstm~f----------YtkQILeGLkYLHen~IVHRDIKGDNVLvNTySGvlKISD  719 (1226)
T KOG4279|consen  665 SKWGPLKDNESTMNF----------YTKQILEGLKYLHENKIVHRDIKGDNVLVNTYSGVLKISD  719 (1226)
T ss_pred             hccCCCccchhHHHH----------HHHHHHHHhhhhhhcceeeccccCCcEEEeeccceEEecc
Confidence            346889885433322          3589999999999999999999999987     8888763


No 10 
>KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms]
Probab=95.36  E-value=0.0073  Score=58.80  Aligned_cols=30  Identities=10%  Similarity=0.153  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .+-+.+|+.+|.|||+ -.|||||+|++|||
T Consensus       181 ~~ia~~VL~GL~YLh~~~~IIHRDIKPsNlL  211 (364)
T KOG0581|consen  181 GKIARAVLRGLSYLHEERKIIHRDIKPSNLL  211 (364)
T ss_pred             HHHHHHHHHHHHHHhhccCeeeccCCHHHee
Confidence            3456899999999996 99999999999997


No 11 
>smart00336 BBOX B-Box-type zinc finger.
Probab=95.30  E-value=0.012  Score=38.44  Aligned_cols=40  Identities=15%  Similarity=-0.020  Sum_probs=28.7

Q ss_pred             ccccccccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           42 RCLLCHVCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        42 RvpLC~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      |.++|..++..+   +.+||..|...||..|... .-.+|...|
T Consensus         2 ~~~~C~~h~~~~---~~~~C~~c~~~iC~~C~~~-~H~~H~~~~   41 (42)
T smart00336        2 RPPKCDSHGDEP---AEFFCEECGALLCRTCDEA-EHRGHTVVL   41 (42)
T ss_pred             cCCcCCCCCCCc---eEEECCCCCcccccccChh-hcCCCceec
Confidence            455665555444   8999999999999999975 225666554


No 12 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=95.09  E-value=0.019  Score=54.46  Aligned_cols=8  Identities=13%  Similarity=-0.135  Sum_probs=3.1

Q ss_pred             cccCCCCc
Q 024658           59 GPKLGPTV   66 (264)
Q Consensus        59 ~~C~~d~~   66 (264)
                      +.|+.|.+
T Consensus       183 ~sCLRCK~  190 (314)
T PF06524_consen  183 YSCLRCKI  190 (314)
T ss_pred             hhhhheee
Confidence            33443333


No 13 
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=95.03  E-value=0.0063  Score=49.77  Aligned_cols=6  Identities=33%  Similarity=0.340  Sum_probs=0.0

Q ss_pred             eecCCC
Q 024658          135 VVPWSG  140 (264)
Q Consensus       135 vVp~s~  140 (264)
                      -|||..
T Consensus        40 e~p~p~   45 (101)
T PF09026_consen   40 EVPVPE   45 (101)
T ss_dssp             ------
T ss_pred             cccchh
Confidence            568866


No 14 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=94.79  E-value=0.019  Score=57.27  Aligned_cols=16  Identities=13%  Similarity=0.023  Sum_probs=9.0

Q ss_pred             hhhccccccccCcchh
Q 024658          234 RGLQNQTMTDQGDAAA  249 (264)
Q Consensus       234 ~~l~~~~i~~~d~~~a  249 (264)
                      ++.-+..+|-+||.++
T Consensus       217 Rr~~K~~~iPQDIDPS  232 (458)
T PF10446_consen  217 RRREKHIPIPQDIDPS  232 (458)
T ss_pred             HHHcCCCCCCCCCCCC
Confidence            3445556666666654


No 15 
>KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=94.57  E-value=0.0099  Score=60.94  Aligned_cols=36  Identities=8%  Similarity=0.027  Sum_probs=32.3

Q ss_pred             ccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          217 RDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       217 ~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.-+++-...+|||.+|+|||+..|||||.|=.|||
T Consensus       115 ltEpEary~l~QIv~GlkYLH~~~IiHRDLKLGNlf  150 (592)
T KOG0575|consen  115 LTEPEARYFLRQIVEGLKYLHSLGIIHRDLKLGNLF  150 (592)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHhcCceecccchhhee
Confidence            556777788899999999999999999999998886


No 16 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=94.56  E-value=0.02  Score=38.11  Aligned_cols=37  Identities=11%  Similarity=0.016  Sum_probs=26.0

Q ss_pred             ccccCCCCceecccCCCCcccCchhhhcccCCCCCCcc
Q 024658           48 VCQSLTPWKASGPKLGPTVSVCDACVAAARCGVNDDDK   85 (264)
Q Consensus        48 ~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~~H~r~p   85 (264)
                      .|..|+...+.+||..|..+||..|.... =.+|..+|
T Consensus         5 ~C~~H~~~~~~~~C~~C~~~~C~~C~~~~-H~~H~~~~   41 (42)
T PF00643_consen    5 KCPEHPEEPLSLFCEDCNEPLCSECTVSG-HKGHKIVP   41 (42)
T ss_dssp             B-SSTTTSBEEEEETTTTEEEEHHHHHTS-TTTSEEEE
T ss_pred             cCccCCccceEEEecCCCCccCccCCCCC-CCCCEEeE
Confidence            34555555599999999999999999953 12255444


No 17 
>KOG0615 consensus Serine/threonine protein kinase Chk2 and related proteins [Cell cycle control, cell division, chromosome partitioning]
Probab=94.28  E-value=0.018  Score=57.45  Aligned_cols=35  Identities=9%  Similarity=0.087  Sum_probs=29.9

Q ss_pred             cCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          218 DHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       218 ~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .++..--...||+..|+|||++.|||||+||-|||
T Consensus       274 ~ed~~K~~f~Qll~avkYLH~~GI~HRDiKPeNIL  308 (475)
T KOG0615|consen  274 REDLGKLLFKQLLTAVKYLHSQGIIHRDIKPENIL  308 (475)
T ss_pred             ccchhHHHHHHHHHHHHHHHHcCcccccCCcceEE
Confidence            34444456789999999999999999999999997


No 18 
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=93.73  E-value=0.018  Score=47.14  Aligned_cols=14  Identities=36%  Similarity=0.681  Sum_probs=0.4

Q ss_pred             hhhccccCCceecC
Q 024658          125 EEEEEDDENQVVPW  138 (264)
Q Consensus       125 ~~~ee~~enqvVp~  138 (264)
                      +++++++++-|--.
T Consensus        33 dddee~de~p~p~f   46 (101)
T PF09026_consen   33 DDDEEEDEVPVPEF   46 (101)
T ss_dssp             -------------H
T ss_pred             ccccccccccchhH
Confidence            33333335555443


No 19 
>PHA02882 putative serine/threonine kinase; Provisional
Probab=93.69  E-value=0.032  Score=49.19  Aligned_cols=29  Identities=7%  Similarity=0.155  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+|++|||
T Consensus       130 ~i~~qi~~~l~~lH~~~iiHrDiKp~Nil  158 (294)
T PHA02882        130 NIMKDMLTTLEYIHEHGISHGDIKPENIM  158 (294)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999996


No 20 
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=93.57  E-value=0.04  Score=55.03  Aligned_cols=16  Identities=13%  Similarity=0.270  Sum_probs=8.6

Q ss_pred             CCCCccccCCCCCCCC
Q 024658          176 DLFSDDEIGCSSRPVT  191 (264)
Q Consensus       176 ~~~s~~~~~~~s~~~~  191 (264)
                      +|--.-++-|.+--..
T Consensus       188 ~LPDSTDFVCGTLDED  203 (458)
T PF10446_consen  188 ELPDSTDFVCGTLDED  203 (458)
T ss_pred             CCCCcccccCCCcCCc
Confidence            4444456667665433


No 21 
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK8 can act as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the multi-subunit core Mediator complex, a cofactor that is involved in regulating RNA p
Probab=93.53  E-value=0.034  Score=48.93  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       112 ~i~~qi~~al~~LH~~~ivHrDlkp~Nil  140 (317)
T cd07868         112 SLLYQILDGIHYLHANWVLHRDLKPANIL  140 (317)
T ss_pred             HHHHHHHHHHHHHHhCCEEcCCCCHHHEE
Confidence            44689999999999999999999999998


No 22 
>KOG0592 consensus 3-phosphoinositide-dependent protein kinase (PDK1) [Signal transduction mechanisms]
Probab=93.40  E-value=0.036  Score=56.86  Aligned_cols=28  Identities=14%  Similarity=0.199  Sum_probs=26.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+||++|.|||+..|||||.|+-|||
T Consensus       179 YAAeIldAleylH~~GIIHRDlKPENIL  206 (604)
T KOG0592|consen  179 YAAEILDALEYLHSNGIIHRDLKPENIL  206 (604)
T ss_pred             HHHHHHHHHHHHHhcCceeccCChhhee
Confidence            3678999999999999999999999997


No 23 
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 6 (CDC2L6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L6 is also called CDK8-like and was previously referred to as CDK11. However, this is a confusing nomenclature as CDC2L6 is distinct from CDC2L1, which is represented by the two protein products from its gene, called CDK11(p110) and CDK11(p58), as well as
Probab=93.32  E-value=0.04  Score=48.19  Aligned_cols=29  Identities=17%  Similarity=0.094  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|+|.|++|||
T Consensus       112 ~i~~qi~~aL~~lH~~~ivH~Dlkp~Nil  140 (317)
T cd07867         112 SLLYQILDGIHYLHANWVLHRDLKPANIL  140 (317)
T ss_pred             HHHHHHHHHHHHHHhCCEEcCCCCHHHEE
Confidence            44579999999999999999999999997


No 24 
>KOG0943 consensus Predicted ubiquitin-protein ligase/hyperplastic discs protein, HECT superfamily [Posttranslational modification, protein turnover, chaperones]
Probab=93.25  E-value=0.055  Score=60.14  Aligned_cols=18  Identities=28%  Similarity=0.497  Sum_probs=10.2

Q ss_pred             cCCCCccccCCCCCCCCC
Q 024658           89 RGGSQSERISGHDETDDD  106 (264)
Q Consensus        89 ~~g~p~~~~~~~d~~~~d  106 (264)
                      |.|.-...+.+||+.+||
T Consensus      1730 f~GEed~~Dddndddddd 1747 (3015)
T KOG0943|consen 1730 FAGEEDHHDDDNDDDDDD 1747 (3015)
T ss_pred             ccCccccccccccccccc
Confidence            666666666666554433


No 25 
>KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis]
Probab=93.25  E-value=0.033  Score=61.34  Aligned_cols=27  Identities=15%  Similarity=0.154  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -++|+++|.|+|++.|||||.||-|||
T Consensus       703 FreIlEGLaYIH~~giIHRDLKP~NIF  729 (1351)
T KOG1035|consen  703 FREILEGLAYIHDQGIIHRDLKPRNIF  729 (1351)
T ss_pred             HHHHHHHHHHHHhCceeeccCCcceeE
Confidence            378999999999999999999999997


No 26 
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 6 (CDK6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK6 is regulated by D-type cyclins and INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein, implicating it to function in regulating the early G1 phase of the cell cycle. It is expressed ubiquitously and is localized in the cytopla
Probab=93.12  E-value=0.042  Score=47.46  Aligned_cols=29  Identities=10%  Similarity=0.095  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       114 ~i~~qi~~aL~~lH~~~iiH~dlkp~Nil  142 (290)
T cd07862         114 DMMFQLLRGLDFLHSHRVVHRDLKPQNIL  142 (290)
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            34578999999999999999999999997


No 27 
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; pseudokinase domain (repeat1). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the ki
Probab=93.08  E-value=0.04  Score=46.22  Aligned_cols=30  Identities=13%  Similarity=0.217  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       104 ~~~~~~i~~~l~~LH~~~i~H~dlkp~Nil  133 (259)
T cd05037         104 LDVAKQLASALHYLEDKKLVHGNVCGKNIL  133 (259)
T ss_pred             HHHHHHHHHHHHHHhhCCeecccCccceEE
Confidence            344579999999999999999999999987


No 28 
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-3 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-3 shows a restricted pattern of expression and is present in brain, kidney, and intestine. It is elevated in Alzheimer's disease (AD) and has been shown to associate with paired helical filament
Probab=93.06  E-value=0.048  Score=47.67  Aligned_cols=29  Identities=3%  Similarity=-0.009  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       107 ~~~~qi~~aL~~LH~~~ivH~dlkp~Nil  135 (288)
T cd07871         107 IFMFQLLRGLSYCHKRKILHRDLKPQNLL  135 (288)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            34578999999999999999999999996


No 29 
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 3 (VEGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR3 (or Flt4) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. V
Probab=92.93  E-value=0.042  Score=49.00  Aligned_cols=28  Identities=18%  Similarity=0.096  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+|+.|||
T Consensus       179 ~~~qi~~aL~~LH~~~ivHrDiKp~Nil  206 (338)
T cd05102         179 YSFQVARGMEFLASRKCIHRDLAARNIL  206 (338)
T ss_pred             HHHHHHHHHHHHHHCCEECCCCccceEE
Confidence            3468999999999999999999999985


No 30 
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK4 has a limited tissue distribution. It is mainly found i
Probab=92.81  E-value=0.05  Score=47.50  Aligned_cols=30  Identities=13%  Similarity=0.169  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|++++|||
T Consensus       105 ~~~~~qi~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05631         105 IFYAAELCCGLEDLQRERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCEEeCCCCHHHEE
Confidence            345678999999999999999999999985


No 31 
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TDY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TDY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. Oryza sativa contains at least 17 MAPKs. There are two subtypes of plant MAPKs based on the conserved phos
Probab=92.77  E-value=0.053  Score=47.84  Aligned_cols=29  Identities=7%  Similarity=0.038  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       107 ~i~~qi~~aL~~LH~~~ivH~dlkp~NIl  135 (338)
T cd07859         107 FFLYQLLRALKYIHTANVFHRDLKPKNIL  135 (338)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            34578999999999999999999999986


No 32 
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. It is activated downstream of PI3K and plays important roles in diverse cellular functions including cell survival, growth, proliferation, angiogenesis, motility, and migration. PKB also has a central role in a variety of human cancers, having be
Probab=92.74  E-value=0.051  Score=48.66  Aligned_cols=28  Identities=14%  Similarity=0.109  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       100 ~~~qi~~~L~~lH~~~ivHrDlkp~NIl  127 (323)
T cd05571         100 YGAEIVSALGYLHSCDVVYRDLKLENLM  127 (323)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHEE
Confidence            3468999999999999999999999996


No 33 
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK2, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=92.67  E-value=0.056  Score=48.26  Aligned_cols=28  Identities=21%  Similarity=0.132  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+|+.|||
T Consensus       110 ~~~qi~~~l~~lH~~~ivHrDlkp~Nil  137 (332)
T cd05614         110 YSGEIILALEHLHKLGIVYRDIKLENIL  137 (332)
T ss_pred             HHHHHHHHHHHHHHCCcEecCCCHHHeE
Confidence            4468999999999999999999999996


No 34 
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGKs are activated by insulin and growth factors via phosphoinositide 3-kinase and PDK1. They activate ion channels, ion carriers, and the Na-K-ATPase, as well as regulate the activity of enzymes and transcription factors. SGKs play important roles in transport, hormone release, neuroexcitability, cell pr
Probab=92.64  E-value=0.054  Score=48.40  Aligned_cols=28  Identities=18%  Similarity=0.114  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|+|++++|||
T Consensus       101 ~~~qi~~~l~~lH~~givH~dikp~NIl  128 (323)
T cd05575         101 YAAEIASALGYLHSLNIIYRDLKPENIL  128 (323)
T ss_pred             HHHHHHHHHHHHHHCCeEeCCCCHHHeE
Confidence            3578999999999999999999999996


No 35 
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, gamma (or Akt3) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-gamma is predominantly expressed in neuronal tissues. Mice deficient in PKB-gamma show a reduction in brain weight due to the decreases in cell size and cell number. PKB-gamma has also been shown to be upregulate
Probab=92.50  E-value=0.057  Score=48.71  Aligned_cols=28  Identities=14%  Similarity=0.146  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.|||
T Consensus       100 ~~~qi~~aL~~LH~~~ivHrDikp~NIl  127 (328)
T cd05593         100 YGAEIVSALDYLHSGKIVYRDLKLENLM  127 (328)
T ss_pred             HHHHHHHHHHHHHhCCeEecccCHHHeE
Confidence            4578999999999999999999999995


No 36 
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK1 is ubiquitously expressed and is under transcriptional control of numerous stimuli including cell stress (cell shrinkage), serum, hormones (gluco- and mineralocorticoids), gonadotropins, growth factors, interleukin-6, and other cytokines. It plays roles in sodium retention and potassium elimination in the kidney, nutrient transport, salt 
Probab=92.49  E-value=0.059  Score=48.20  Aligned_cols=28  Identities=18%  Similarity=0.121  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|||.+++|||
T Consensus       101 ~~~qi~~~L~~lH~~giiHrDlkp~Nil  128 (325)
T cd05602         101 YAAEIASALGYLHSLNIVYRDLKPENIL  128 (325)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            3478999999999999999999999985


No 37 
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity 
Probab=92.24  E-value=0.059  Score=45.99  Aligned_cols=29  Identities=14%  Similarity=0.098  Sum_probs=26.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|++||++.|+|+|.++++||-
T Consensus       105 ~~~qi~~~l~~lH~~~iiH~dlkp~nili  133 (258)
T cd05078         105 VAKQLAWALHFLEDKGLTHGNVCAKNVLL  133 (258)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCccceEEE
Confidence            45789999999999999999999999874


No 38 
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase (Aatyk) subfamily; catalytic (c) domain. The Aatyk subfamily is also referred to as the lemur tyrosine kinase (Lmtk) subfamily. It consists of Aatyk1 (Lmtk1), Aatyk2 (Lmtk2, Brek), Aatyk3 (Lmtk3), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk proteins are mostly receptor tyr kinases (RTKs) containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 does not contain a transmembrane segment and is a cytoplasmic (or nonreceptor) kinase. Aatyk proteins are classified as tyr kina
Probab=92.22  E-value=0.067  Score=45.66  Aligned_cols=29  Identities=14%  Similarity=0.048  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus       104 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  132 (269)
T cd05042         104 RMACEVASGLLWLHQADFIHSDLALRNCQ  132 (269)
T ss_pred             HHHHHHHHHHHHHHhcCEecccccHhheE
Confidence            34568999999999999999999999985


No 39 
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. NDR1 is highly expressed in thymus, mus
Probab=92.21  E-value=0.065  Score=48.95  Aligned_cols=31  Identities=0%  Similarity=0.009  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|||.|+.|||
T Consensus       103 ~~~~~~qi~~aL~~lH~~givHrDlKp~NIL  133 (363)
T cd05628         103 TQFYIAETVLAIDSIHQLGFIHRDIKPDNLL  133 (363)
T ss_pred             HHHHHHHHHHHHHHHHhCCeEecCCCHHHeE
Confidence            3445678999999999999999999999996


No 40 
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EGFR (HER1, ErbB1) is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphor
Probab=92.20  E-value=0.066  Score=47.44  Aligned_cols=28  Identities=14%  Similarity=0.187  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++.|||
T Consensus       114 ~~~qi~~~L~~LH~~~iiH~dlkp~Nil  141 (316)
T cd05108         114 WCVQIAKGMNYLEERRLVHRDLAARNVL  141 (316)
T ss_pred             HHHHHHHHHHHHHhcCeeccccchhheE
Confidence            4568999999999999999999999986


No 41 
>PHA03212 serine/threonine kinase US3; Provisional
Probab=92.20  E-value=0.069  Score=50.25  Aligned_cols=29  Identities=10%  Similarity=0.198  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+|++|||
T Consensus       186 ~i~~qi~~aL~ylH~~~IvHrDiKP~NIl  214 (391)
T PHA03212        186 AIERSVLRAIQYLHENRIIHRDIKAENIF  214 (391)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChHhEE
Confidence            34568999999999999999999999996


No 42 
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38beta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38beta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38beta, also called MAPK11, is 
Probab=92.18  E-value=0.062  Score=48.17  Aligned_cols=29  Identities=3%  Similarity=0.088  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       122 ~i~~qi~~aL~~LH~~~ivHrdikp~Nil  150 (343)
T cd07878         122 FLIYQLLRGLKYIHSAGIIHRDLKPSNVA  150 (343)
T ss_pred             HHHHHHHHHHHHHHHCCeecccCChhhEE
Confidence            34578999999999999999999999985


No 43 
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK2 (or ROK-alpha) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK2 was the first identified target of activated RhoA, and was found 
Probab=92.16  E-value=0.066  Score=49.68  Aligned_cols=28  Identities=4%  Similarity=0.172  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       147 ~~~qil~aL~~LH~~~IvHrDLKp~NIL  174 (370)
T cd05621         147 YTAEVVLALDAIHSMGLIHRDVKPDNML  174 (370)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            4468999999999999999999999985


No 44 
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), NDR kinase subfamily, fungal NDR-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group is composed of fungal NDR-like proteins including Saccharomyces cerevisiae CBK1 (or CBK1p), Schizosaccharomyces pombe Orb6 (or Orb6p), Ustilago maydis Ukc1 (or Ukc1p), and Neurospora crassa Cot1. Like NDR kinase, group members contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. CBK1 is an essential component in the RAM (regulation of 
Probab=92.13  E-value=0.069  Score=48.90  Aligned_cols=27  Identities=4%  Similarity=0.079  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~ql~~aL~~LH~~givHrDlkp~NIl  133 (377)
T cd05629         107 MAECVLAIEAVHKLGFIHRDIKPDNIL  133 (377)
T ss_pred             HHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            578999999999999999999999997


No 45 
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-1 is widely expressed except in the spleen and thymus. It is highly expressed in the brain, heart, pancreas, testis, and ovary, and is localized in the cytoplasm. It is regulated by cyclin D3 an
Probab=92.09  E-value=0.068  Score=46.98  Aligned_cols=28  Identities=4%  Similarity=0.030  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.|+.|||
T Consensus       108 ~~~qi~~al~~lH~~~ivH~dlkp~Nil  135 (303)
T cd07869         108 FLFQLLRGLSYIHQRYILHRDLKPQNLL  135 (303)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4478999999999999999999999996


No 46 
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Fission yeast Suppressor of loss of cAMP-dependent protein kinase (Sck1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sck1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the Schizosaccharomyces pombe STK Sck1. Sck1 plays a role in trehalase activation triggered by glucose and a nitrogen source. Trehalase catalyzes the cleavage of the disaccharide trehalose to glucose. Trehalose, as a carbohydrate reserve and stress metabolite, plays an important role in the response of
Probab=92.07  E-value=0.067  Score=47.85  Aligned_cols=28  Identities=11%  Similarity=0.107  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qil~al~~LH~~~ivHrDlkp~Nil  128 (330)
T cd05586         101 YIAELVLALEHLHKYDIVYRDLKPENIL  128 (330)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            3468999999999999999999999996


No 47 
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalyt
Probab=92.06  E-value=0.075  Score=46.26  Aligned_cols=30  Identities=17%  Similarity=0.258  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       120 ~~i~~qi~~~l~~lH~~~iiH~dlkp~Nil  149 (274)
T cd05076         120 ITVAQQLASALSYLEDKNLVHGNVCAKNIL  149 (274)
T ss_pred             HHHHHHHHHHHHHHHcCCccCCCCCcccEE
Confidence            345678999999999999999999999997


No 48 
>PTZ00036 glycogen synthase kinase; Provisional
Probab=92.06  E-value=0.07  Score=50.99  Aligned_cols=27  Identities=7%  Similarity=0.091  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.|+.|||
T Consensus       176 ~~qi~~gL~yLH~~~IiHrDLKp~NIL  202 (440)
T PTZ00036        176 SYQLCRALAYIHSKFICHRDLKPQNLL  202 (440)
T ss_pred             HHHHHHHHHHHHHCCEecCCcCHHHEE
Confidence            358999999999999999999999987


No 49 
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta. Protein Kinase family, STE20-related kinase adapter protein (STRAD) beta subfamily, pseudokinase domain. The STRAD-beta subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpig
Probab=92.03  E-value=0.071  Score=47.63  Aligned_cols=29  Identities=14%  Similarity=0.064  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.|++|||
T Consensus       105 ~~~~qi~~aL~~lH~~~ivHrDlkp~Nil  133 (328)
T cd08226         105 NILFGALRGLNYLHQNGYIHRNIKASHIL  133 (328)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            44578999999999999999999999996


No 50 
>KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism]
Probab=92.01  E-value=0.058  Score=52.66  Aligned_cols=34  Identities=9%  Similarity=0.218  Sum_probs=30.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH-----hhhhcc
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT-----GICRLS  258 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~-----~ic~l~  258 (264)
                      -+-||..+|.|||+..|-|||+|+.|||     |+-|||
T Consensus       130 Yt~Qlfrgl~yLh~~~IcHRDIKPqNlLvD~~tg~LKic  168 (364)
T KOG0658|consen  130 YTYQLFRGLAYLHSHGICHRDIKPQNLLVDPDTGVLKIC  168 (364)
T ss_pred             HHHHHHHHHHHHHhcCcccCCCChheEEEcCCCCeEEec
Confidence            3579999999999999999999999997     666665


No 51 
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Yeast protein kinase 1 (YPK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YPK1-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of fungal proteins with similarity to the AGC STKs, Saccharomyces cerevisiae YPK1 and Schizosaccharomyces pombe Gad8p. YPK1 is required for cell growth and acts as a downstream kinase in the sphingolipid-mediated signaling pathway of yeast. It also plays a role in efficient endocytosis and in the maintenance of cell wall integrity. Gad8p is a downstream target of Tor1p, the fission yeast homolog of mTOR. It pl
Probab=91.97  E-value=0.075  Score=47.25  Aligned_cols=28  Identities=11%  Similarity=0.167  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.+++|||
T Consensus        98 ~~~qi~~~l~~lH~~~i~HrDlkp~Nil  125 (312)
T cd05585          98 YTAELLCALENLHKFNVIYRDLKPENIL  125 (312)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHeE
Confidence            4568999999999999999999999985


No 52 
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 3 (JNK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK3 is expressed primarily in the brain, and to a lesser extent in the heart and testis. Mice deficient in Jnk3 are protected against kainic acid-induced seizures, strok
Probab=91.96  E-value=0.077  Score=47.94  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       124 ~~~qi~~aL~~LH~~givHrDikp~Nil  151 (355)
T cd07874         124 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  151 (355)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCChHHEE
Confidence            4578999999999999999999999996


No 53 
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C. Serine/Threonine Kinases (STKs), Classical (or Conventional) Protein Kinase C (cPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. cPKCs contain a calcium-binding C2 region in their regulatory
Probab=91.92  E-value=0.076  Score=47.50  Aligned_cols=30  Identities=13%  Similarity=0.018  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       104 ~~~~~qi~~al~~lH~~~ivH~dlkp~Nil  133 (324)
T cd05587         104 VFYAAEIAIGLFFLHSKGIIYRDLKLDNVM  133 (324)
T ss_pred             HHHHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            345678999999999999999999999996


No 54 
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. LATS2 is an essential mitotic regulator responsible for coordinating accurate cytokinesis completion and governing the stabilization of other mitotic regulators. It is also critical in the maintenance of proper chromosome number, genomic stability, mitotic fidelity, and the integrity of centrosome duplication. Downregulation of LATS2 is associated with po
Probab=91.91  E-value=0.072  Score=49.10  Aligned_cols=27  Identities=4%  Similarity=0.083  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       107 ~~qi~~aL~~LH~~givHrDlKp~Nil  133 (381)
T cd05626         107 IAELTLAIESVHKMGFIHRDIKPDNIL  133 (381)
T ss_pred             HHHHHHHHHHHHhCCeeecCCcHHHEE
Confidence            468999999999999999999999996


No 55 
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3. SGK2 shows a more restricted distribution that SGK1 and is most abundantly expressed in epithelial tissues including kidney, liver, pancreas, and the choroid plexus of the brain. In vitro cellular assays show that SGK2 can stimulate the activity of ion channels, the glutamate transporter EEAT4, and the glutamate receptors, GluR6 and GLUR1.
Probab=91.89  E-value=0.075  Score=47.35  Aligned_cols=28  Identities=11%  Similarity=0.089  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~~L~~lH~~~ivH~Dlkp~NIl  128 (321)
T cd05603         101 YAAEVASAIGYLHSLNIIYRDLKPENIL  128 (321)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            3578999999999999999999999986


No 56 
>PHA03210 serine/threonine kinase US3; Provisional
Probab=91.88  E-value=0.076  Score=51.78  Aligned_cols=28  Identities=4%  Similarity=0.112  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|++|||
T Consensus       272 i~~ql~~aL~yLH~~gIiHrDLKP~NIL  299 (501)
T PHA03210        272 IMKQLLCAVEYIHDKKLIHRDIKLENIF  299 (501)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3468889999999999999999999986


No 57 
>PLN00181 protein SPA1-RELATED; Provisional
Probab=91.85  E-value=0.07  Score=54.79  Aligned_cols=29  Identities=7%  Similarity=0.069  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.|||++.|+|||.|++|||
T Consensus        84 ~i~~qi~~al~~lH~~gIvHrDlKP~NiL  112 (793)
T PLN00181         84 HVFRQIVEIVNAAHSQGIVVHNVRPSCFV  112 (793)
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCCchhEE
Confidence            34579999999999999999999999998


No 58 
>PHA03207 serine/threonine kinase US3; Provisional
Probab=91.70  E-value=0.085  Score=49.04  Aligned_cols=29  Identities=10%  Similarity=0.157  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+|++|||
T Consensus       189 ~i~~ql~~aL~~LH~~givHrDlkp~Nil  217 (392)
T PHA03207        189 TIQRRLLEALAYLHGRGIIHRDVKTENIF  217 (392)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            44578999999999999999999999986


No 59 
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 partners with all three D-type cyclins (D1, D2, and D3) and is also regulated by INK4 inhibitors. It is active towards the retinoblastoma (pRb) protein and plays a role in regulating the early G1 phase of the cell cycle. It is expressed ubiquitou
Probab=91.70  E-value=0.083  Score=45.43  Aligned_cols=29  Identities=10%  Similarity=0.082  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 ~~~~qi~~al~~lH~~~ivH~dikp~Nil  140 (288)
T cd07863         112 DLMRQFLRGLDFLHANCIVHRDLKPENIL  140 (288)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999987


No 60 
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha. Protein Kinase family, STE20-related kinase adapter protein (STRAD) alpha subfamily, pseudokinase domain. The STRAD alpha subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hype
Probab=91.68  E-value=0.074  Score=47.50  Aligned_cols=28  Identities=11%  Similarity=0.122  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       106 i~~qi~~~L~~LH~~~iiH~dlkp~Nil  133 (327)
T cd08227         106 ILQGVLKALDYIHHMGYVHRSVKASHIL  133 (327)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCChhhEE
Confidence            3467899999999999999999999996


No 61 
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), epsilon isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-epsilon has been shown to behave as an oncoprotein. Its overexpression contributes to
Probab=91.64  E-value=0.086  Score=47.09  Aligned_cols=28  Identities=11%  Similarity=0.007  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       101 ~~~qi~~aL~~LH~~~ivHrDikp~Nil  128 (321)
T cd05591         101 YAAEVTLALMFLHRHGVIYRDLKLDNIL  128 (321)
T ss_pred             HHHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            4578999999999999999999999996


No 62 
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 2 (JNK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=91.64  E-value=0.087  Score=47.78  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       128 ~~~qi~~~L~~LH~~~ivHrDlkp~NIl  155 (359)
T cd07876         128 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  155 (359)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            3468999999999999999999999996


No 63 
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS was originally identified in Drosophila using a screen for genes whose inactivation led to overproliferation of cells. In tetrapods, there are two LATS isoforms, LATS1 and LATS2. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. LATS functions as a tumor suppressor and is implicated in cell cycle regulation.
Probab=91.61  E-value=0.08  Score=48.34  Aligned_cols=27  Identities=4%  Similarity=0.110  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~qi~~al~~lH~~~ivHrDlkp~Nil  133 (376)
T cd05598         107 IAELTCAIESVHKMGFIHRDIKPDNIL  133 (376)
T ss_pred             HHHHHHHHHHHHHCCeEeCCCCHHHEE
Confidence            468999999999999999999999996


No 64 
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), delta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-delta plays a role in cell cycle regulation and programmed cell death in many cell types. I
Probab=91.61  E-value=0.087  Score=47.19  Aligned_cols=28  Identities=11%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~~l~~lH~~~ivHrDlkp~Nil  128 (316)
T cd05620         101 YAAEIVCGLQFLHSKGIIYRDLKLDNVM  128 (316)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            4468999999999999999999999985


No 65 
>PTZ00284 protein kinase; Provisional
Probab=91.55  E-value=0.087  Score=50.22  Aligned_cols=29  Identities=7%  Similarity=-0.104  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|.+||.+ .|+|||+|++|||-
T Consensus       236 i~~qi~~aL~yLH~~~gIiHrDlKP~NILl  265 (467)
T PTZ00284        236 IIFQTGVALDYFHTELHLMHTDLKPENILM  265 (467)
T ss_pred             HHHHHHHHHHHHHhcCCeecCCCCHHHEEE
Confidence            346889999999974 99999999999973


No 66 
>PLN03225 Serine/threonine-protein kinase SNT7; Provisional
Probab=91.55  E-value=0.082  Score=53.06  Aligned_cols=27  Identities=19%  Similarity=0.286  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|++|||
T Consensus       261 ~~qll~aL~yLH~~gIiHRDLKP~NIL  287 (566)
T PLN03225        261 MRQILFALDGLHSTGIVHRDVKPQNII  287 (566)
T ss_pred             HHHHHHHHHHHHHCCEEeCcCCHHHEE
Confidence            467899999999999999999999996


No 67 
>PHA03209 serine/threonine kinase US3; Provisional
Probab=91.51  E-value=0.089  Score=48.14  Aligned_cols=28  Identities=21%  Similarity=0.239  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+|+.|||
T Consensus       162 i~~qi~~aL~~LH~~~ivHrDlkp~Nil  189 (357)
T PHA03209        162 IEKQILEGLRYLHAQRIIHRDVKTENIF  189 (357)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4478999999999999999999999996


No 68 
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, PRKX-like kinases, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include human PRKX (X chromosome-encoded protein kinase), Drosophila DC2, and similar proteins. PRKX is present in many tissues including fetal and adult brain, kidney, and lung. The PRKX gene is located in the Xp22.3 subregion and has a homolog called PRKY on the Y chromosome. An abnormal interchange between PRKX aand PRKY leads to the sex reversal disorder of XX males and XY females. PRKX is implicated in granulocyt
Probab=91.50  E-value=0.091  Score=46.15  Aligned_cols=29  Identities=14%  Similarity=0.161  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       105 ~~~~qi~~~l~~lH~~~i~H~dlkp~NIl  133 (291)
T cd05612         105 FYASEIVCALEYLHSKEIVYRDLKPENIL  133 (291)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCCCHHHeE
Confidence            34578999999999999999999999997


No 69 
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase. Serine/Threonine Kinases (STKs), Nemo-Like Kinase (NLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mitogen-activated protein kinases (MAPKs) are important mediators of cellular responses to extracellular signals. NLK is an atypical MAPK that is not regulated by a MAPK kinase. It functions downstream of the MAPK kinase kinase Tak1, which also plays a role in activating the JNK and p38 MAPKs. The Tak1/NLK pathways are regulated by Wnts, a family of secreted proteins that is critical in the control of asymmetric division and cell polarity. NLK can phosphorylate transcription
Probab=91.47  E-value=0.094  Score=47.92  Aligned_cols=28  Identities=11%  Similarity=0.099  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~qi~~aL~~LH~~~ivH~dlkp~Nil  135 (372)
T cd07853         108 FLYQILRGLKYLHSAGILHRDIKPGNLL  135 (372)
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCChHHEE
Confidence            4578999999999999999999999986


No 70 
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, beta (or Akt2) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-beta is the predominant PKB isoform expressed in insulin-responsive tissues. It plays a critical role in the regulation of glucose homeostasis. It is also implicated in muscle cell differentiation. Mice deficient in
Probab=91.47  E-value=0.085  Score=47.38  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus        99 ~~~~qi~~aL~~LH~~~ivH~Dlkp~NIl  127 (323)
T cd05595          99 FYGAEIVSALEYLHSRDVVYRDIKLENLM  127 (323)
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            34578999999999999999999999985


No 71 
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2. Protein Tyrosine Kinase (PTK) family; HER2 (ErbB2, HER2/neu); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER2 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve
Probab=91.46  E-value=0.078  Score=45.63  Aligned_cols=30  Identities=13%  Similarity=0.165  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 ~~~~~qi~~~L~~lH~~~iiH~dlkp~Nil  141 (279)
T cd05109         112 LNWCVQIAKGMSYLEEVRLVHRDLAARNVL  141 (279)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccccccceEE
Confidence            445689999999999999999999999986


No 72 
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl. Protein Tyrosine Kinase (PTK) family; Axl; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl is widely expressed in a variety of organs and cells including epithelial, mesenchymal, hematopoietic, as well as non-transfor
Probab=91.46  E-value=0.089  Score=44.71  Aligned_cols=28  Identities=21%  Similarity=0.144  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       117 ~~~~i~~~l~~lH~~~i~H~dlkp~Nil  144 (272)
T cd05075         117 FMTDIASGMEYLSSKSFIHRDLAARNCM  144 (272)
T ss_pred             HHHHHHHHHHHHHHCCeeccccchhheE
Confidence            3467899999999999999999999987


No 73 
>KOG0660 consensus Mitogen-activated protein kinase [Signal transduction mechanisms]
Probab=91.44  E-value=0.079  Score=51.68  Aligned_cols=31  Identities=6%  Similarity=0.071  Sum_probs=27.9

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+--||+-+|||+|+..|+|||.|++|||
T Consensus       127 ~q~f~YQiLrgLKyiHSAnViHRDLKPsNll  157 (359)
T KOG0660|consen  127 AQYFLYQILRGLKYIHSANVIHRDLKPSNLL  157 (359)
T ss_pred             HHHHHHHHHHhcchhhcccccccccchhhee
Confidence            3456679999999999999999999999997


No 74 
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-2 is specifically expressed in neurons in the central nervous system, mainly in terminally differentiated neurons. It associates with Trap (Tudor repeat associator with PCTAIRE-2) and could play
Probab=91.40  E-value=0.097  Score=46.11  Aligned_cols=28  Identities=7%  Similarity=0.000  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       109 ~~~qi~~aL~~lH~~~ivH~dlkp~Nil  136 (309)
T cd07872         109 FLYQILRGLAYCHRRKVLHRDLKPQNLL  136 (309)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4568999999999999999999999985


No 75 
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) and Nuclear Dbf2-Related (NDR)-like kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK- and NDR-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include ROCK and ROCK-like proteins such as DMPK, MRCK, and CRIK, as well as NDR and NDR-like proteins such as LATS, CBK1 and Sid2p. ROCK and CRIK are effectors of the small GTPase Rho, while MRCK is an effector of the small GTPase Cdc42. NDR and NDR-like kinases contain an N-terminal regulatory (NTR) domain and an insert within the 
Probab=91.38  E-value=0.091  Score=46.88  Aligned_cols=27  Identities=7%  Similarity=0.127  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       107 ~~qi~~aL~~LH~~giiH~Dlkp~NIl  133 (350)
T cd05573         107 IAELVLALDSVHKLGFIHRDIKPDNIL  133 (350)
T ss_pred             HHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            468999999999999999999999996


No 76 
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplica
Probab=91.37  E-value=0.092  Score=47.48  Aligned_cols=28  Identities=4%  Similarity=0.033  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       106 ~~~qi~~aL~~lH~~~ivH~Dlkp~NIl  133 (364)
T cd05599         106 YIAETILAIDSIHKLGYIHRDIKPDNLL  133 (364)
T ss_pred             HHHHHHHHHHHHHHCCeEeccCCHHHeE
Confidence            4478999999999999999999999996


No 77 
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3. Serine/Threonine Kinases (STKs), Serum- and Glucocorticoid-induced Kinase (SGK) subfamily, SGK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three isoforms of SGK, named SGK1, SGK2, and SGK3 (also called cytokine-independent survival kinase CISK). SGK3 is expressed in most tissues and is most abundant in the embryo and adult heart and spleen. It was originally discovered in a screen for antiapoptotic genes. It phosphorylates and inhibits the proapoptotic proteins, Bad and FKHRL1. SGK3 also regulates many transporters, ion channels,
Probab=91.28  E-value=0.093  Score=46.94  Aligned_cols=28  Identities=18%  Similarity=0.118  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       101 ~~~qi~~al~~lH~~givH~Dlkp~NIl  128 (325)
T cd05604         101 YAAEIASALGYLHSINIVYRDLKPENIL  128 (325)
T ss_pred             HHHHHHHHHHHHHHCCeeecCCCHHHeE
Confidence            4578999999999999999999999986


No 78 
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 1 (DDR1) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR1 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR1 binds to all collagens tested to date (types I-IV). It is widely expressed in many tissues. It is abundant in the brain and is also found in k
Probab=91.24  E-value=0.1  Score=45.77  Aligned_cols=29  Identities=14%  Similarity=0.094  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++|||
T Consensus       142 ~i~~~i~~al~~lH~~~ivH~dlkp~Nil  170 (304)
T cd05096         142 HVALQIASGMKYLSSLNFVHRDLATRNCL  170 (304)
T ss_pred             HHHHHHHHHHHHHHHCCccccCcchhheE
Confidence            45678999999999999999999999997


No 79 
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1. Serine/Threonine Kinases (STKs), Large Tumor Suppressor (LATS) subfamily, LATS1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The LATS subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. LATS functions as a tumor suppressor and is implicated in cell cycle regulation. Inactivation of LATS1 in mice results in the development of various tumors, including sarcomas and ovarian cancer. Promoter methylation, loss of heterozygosity, and missense mutations targeting the LATS1 gene have also been found in human sarcomas and ovarian cancers. In addition, decreased expression of LATS1 is associated with an aggressive phenotype an
Probab=91.22  E-value=0.097  Score=48.02  Aligned_cols=27  Identities=4%  Similarity=0.097  Sum_probs=25.4

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||+|+.|||
T Consensus       107 ~~qi~~al~~lH~~~ivHrDlKp~NIL  133 (382)
T cd05625         107 IAELTCAVESVHKMGFIHRDIKPDNIL  133 (382)
T ss_pred             HHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            468999999999999999999999997


No 80 
>PTZ00263 protein kinase A catalytic subunit; Provisional
Probab=91.20  E-value=0.099  Score=47.09  Aligned_cols=27  Identities=4%  Similarity=0.114  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|+++.|||
T Consensus       124 ~~qi~~aL~~LH~~~ivH~dlkp~NIl  150 (329)
T PTZ00263        124 HAELVLAFEYLHSKDIIYRDLKPENLL  150 (329)
T ss_pred             HHHHHHHHHHHHHCCeeecCCCHHHEE
Confidence            468999999999999999999999986


No 81 
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, beta isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, and
Probab=91.14  E-value=0.1  Score=46.69  Aligned_cols=30  Identities=13%  Similarity=0.018  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|||.++.|||
T Consensus       104 ~~~~~qi~~aL~~LH~~~ivHrDlkp~Nil  133 (323)
T cd05616         104 VFYAAEIAIGLFFLHSKGIIYRDLKLDNVM  133 (323)
T ss_pred             HHHHHHHHHHHHHHHHCCEEecCCCHHHeE
Confidence            345678999999999999999999999985


No 82 
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta and delta-like isoforms, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an imp
Probab=91.07  E-value=0.1  Score=46.67  Aligned_cols=28  Identities=14%  Similarity=0.138  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.|||
T Consensus       101 ~~~qi~~al~~LH~~~ivH~dlkp~Nil  128 (316)
T cd05592         101 YAAEIICGLQFLHKKGIIYRDLKLDNVL  128 (316)
T ss_pred             HHHHHHHHHHHHHHCCEEeCCCCHHHeE
Confidence            3578999999999999999999999996


No 83 
>PLN00034 mitogen-activated protein kinase kinase; Provisional
Probab=91.03  E-value=0.1  Score=47.34  Aligned_cols=29  Identities=10%  Similarity=0.190  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.|||
T Consensus       172 ~i~~qi~~aL~~LH~~~ivHrDlkp~NIl  200 (353)
T PLN00034        172 DVARQILSGIAYLHRRHIVHRDIKPSNLL  200 (353)
T ss_pred             HHHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            34578999999999999999999999996


No 84 
>KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=91.03  E-value=0.097  Score=53.42  Aligned_cols=34  Identities=9%  Similarity=0.047  Sum_probs=29.7

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+|--....||+.+|+|+|++.|.|||+|++|||
T Consensus       217 ~~qIKc~mkQLl~Gl~~cH~~gvlHRDIK~SNiL  250 (560)
T KOG0600|consen  217 EPQIKCYMKQLLEGLEYCHSRGVLHRDIKGSNIL  250 (560)
T ss_pred             hHHHHHHHHHHHHHHHHHhhcCeeeccccccceE
Confidence            3445556679999999999999999999999997


No 85 
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) MPK1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MPK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs MPK1 from Saccharomyces cerevisiae, Pmk1 from Schizosaccharomyces pombe, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. MPK1 (also called Slt2) and Pmk1 (also called Spm1) are stress-activated MAPKs that regulate the cell wall integrity (CWI) pathway, and are therefore important in the maintainance of cell shape, cell wall co
Probab=91.02  E-value=0.12  Score=46.34  Aligned_cols=29  Identities=10%  Similarity=0.119  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.++.|||
T Consensus       109 ~~~~qi~~aL~~LH~~givH~dlkp~Nil  137 (332)
T cd07857         109 SFIYQILCGLKYIHSANVLHRDLKPGNLL  137 (332)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHeE
Confidence            34578999999999999999999999985


No 86 
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 2 (Ror2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=91.00  E-value=0.1  Score=44.92  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.+++||+
T Consensus       129 ~~~ql~~aL~~lH~~gi~H~dlkp~Nil  156 (283)
T cd05091         129 IVTQIAAGMEFLSSHHVVHKDLATRNVL  156 (283)
T ss_pred             HHHHHHHHHHHHHHcCccccccchhheE
Confidence            3468999999999999999999999996


No 87 
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 2 (Aatyk2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk2 is a member of the Aatyk subfamily of proteins, which are receptor kinases containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk2 is also called lemur tyrosine kinase 2 (Lmtk2) or brain-enriched kinase (Brek). It is expressed at high levels in early postnatal brain, and has been shown to play a role in nerve growth factor (NGF) signaling. Studies with knockout mice reveal that Aatyk2 is essential for late stage
Probab=90.99  E-value=0.097  Score=45.04  Aligned_cols=27  Identities=7%  Similarity=0.076  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|++++|||
T Consensus       105 ~~~i~~al~~lH~~~i~H~dikp~nil  131 (268)
T cd05086         105 ACEIAAGVTHMHKHNFLHSDLALRNCF  131 (268)
T ss_pred             HHHHHHHHHHHHHCCeeccCCccceEE
Confidence            468999999999999999999999986


No 88 
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); pseudokinase domain (repeat 1). The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. The pseudokinase domain shows similarity to tyr kinases but lacks crucial residues for catalytic activity and ATP binding. It modulates the kinase activity of the C-terminal catalytic dom
Probab=90.93  E-value=0.11  Score=44.78  Aligned_cols=32  Identities=13%  Similarity=0.129  Sum_probs=28.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..+...+|+.+|.+||++.|+|+|.++.|||=
T Consensus       107 ~~~i~~qi~~~l~~lH~~~ivH~dlkp~Nill  138 (262)
T cd05077         107 KFKVAKQLASALSYLEDKDLVHGNVCTKNILL  138 (262)
T ss_pred             HHHHHHHHHHHHHHhhhCCeECCCCCcccEEE
Confidence            34556899999999999999999999999874


No 89 
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK1 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK1, also called rhodopsin kinase, belongs to the visual g
Probab=90.92  E-value=0.12  Score=45.04  Aligned_cols=29  Identities=17%  Similarity=0.188  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       101 ~~~~qi~~~l~~lH~~~i~H~dlkp~Nil  129 (280)
T cd05608         101 FYTAQIISGLEHLHQRRIIYRDLKPENVL  129 (280)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            45578999999999999999999999986


No 90 
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase. Serine/Threonine Kinases (STKs), Citron Rho-interacting kinase (CRIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CRIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CRIK is also called citron kinase. It contains a catalytic domain, a central coiled-coil domain, and a C-terminal region containing a Rho-binding domain (RBD), a zinc finger, and a pleckstrin homology (PH) domain, in addition to other motifs. CRIK, an effector of the small GTPase Rho, plays an important function during cytokinesis and affects its contractile process. CRIK-deficient mice show severe ataxia and epilepsy as a result of abnor
Probab=90.91  E-value=0.1  Score=46.55  Aligned_cols=27  Identities=0%  Similarity=0.103  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|++||++.|+|||.++.|||
T Consensus       108 ~~qi~~aL~~lH~~~i~H~Dlkp~NIl  134 (330)
T cd05601         108 LAELVLAIHSVHQMGYVHRDIKPENVL  134 (330)
T ss_pred             HHHHHHHHHHHHHCCeEcccCchHheE
Confidence            468999999999999999999999996


No 91 
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 70 kDa ribosomal protein S6 kinase (p70S6K) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p70S6K subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p70S6K (or S6K) contains only one catalytic kinase domain, unlike p90 ribosomal S6 kinases (RSKs). It acts as a downstream effector of the STK mTOR (mammalian Target of Rapamycin) and plays a role in the regulation of the translation machinery during protein synthesis. p70S6K also plays a pivotal role in regulating cell size and glucose homeostasis. Its targets include S6, the translation initiation factor eIF3, and the in
Probab=90.91  E-value=0.11  Score=46.57  Aligned_cols=28  Identities=18%  Similarity=0.101  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       105 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  132 (323)
T cd05584         105 YLSEISLALEHLHQQGIIYRDLKPENIL  132 (323)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            3568999999999999999999999997


No 92 
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase 1 (JNK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. Vetebrates harbor three different JNK genes (Jnk1, Jnk2, and Jnk3). JNK1, like JNK2, is expressed in every cell and tissue type. Initially it was thought that JNK1 and JNK2 were functionally redundant as mice deficient in either genes (Jn
Probab=90.83  E-value=0.11  Score=47.11  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+++.|||
T Consensus       131 ~~~qi~~aL~~LH~~~ivH~Dlkp~NIl  158 (364)
T cd07875         131 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  158 (364)
T ss_pred             HHHHHHHHHHHHhhCCeecCCCCHHHEE
Confidence            3578999999999999999999999986


No 93 
>KOG0579 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=90.77  E-value=0.072  Score=56.43  Aligned_cols=48  Identities=17%  Similarity=0.133  Sum_probs=39.4

Q ss_pred             HHhhhhcccCCCCCCCCCCCCCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          193 EEAAASMSSYRPLKQPRPTISDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       193 ~~~~~s~~s~Rplk~~~i~~~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+.|+.=-|+|++.-|-   .|         -.++++.|++||++.|||||.|+.|||
T Consensus       115 AVDaimlEL~r~LtE~QIq---vv---------c~q~ldALn~LHs~~iIHRDLKAGNiL  162 (1187)
T KOG0579|consen  115 AVDAIMLELGRVLTEDQIQ---VV---------CYQVLDALNWLHSQNIIHRDLKAGNIL  162 (1187)
T ss_pred             hHhHHHHHhccccchHHHH---HH---------HHHHHHHHHHHhhcchhhhhccccceE
Confidence            3467788888999987761   11         357899999999999999999999997


No 94 
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4. Protein Tyrosine Kinase (PTK) family; Colon Carcinoma Kinase 4 (CCK4); pseudokinase domain. The PTKc (catalytic domain) family, to which this subfamily belongs, includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CCK4, also called protein tyrosine kinase 7 (PTK7), is an orphan receptor tyr kinase (RTK) containing an extracellular region with seven immunoglobulin domains, a transmembrane segment, and an intracellular inactive pseudokinase domain. Studies in mice reveal that CCK4 is essential for neural development. Mouse embryos containing a truncated CCK4 die perinatally and display craniorachischisis, a severe form of neural tube defect. The mechanism of action of the CCK4 pseudokinase is s
Probab=90.71  E-value=0.11  Score=44.43  Aligned_cols=30  Identities=23%  Similarity=0.180  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus       120 ~~~~~~l~~~l~~LH~~~i~H~dlkp~Nil  149 (275)
T cd05046         120 VALCTQIALGMDHLSNARFVHRDLAARNCL  149 (275)
T ss_pred             HHHHHHHHHHHHHhhhcCcccCcCccceEE
Confidence            345578999999999999999999999976


No 95 
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase. Serine/Threonine Kinases (STKs), Rho-associated coiled-coil containing protein kinase (ROCK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK is also referred to as Rho-associated kinase or simply as Rho kinase. It contains an N-terminal extension, a catalytic kinase domain, and a long C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain. It is activated via in
Probab=90.71  E-value=0.12  Score=47.84  Aligned_cols=27  Identities=4%  Similarity=0.186  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|||.++.|||
T Consensus       148 ~~qi~~aL~~LH~~~ivHrDLkp~NIL  174 (370)
T cd05596         148 TAEVVLALDAIHSMGFIHRDVKPDNML  174 (370)
T ss_pred             HHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            468999999999999999999999986


No 96 
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), eta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-eta is predominantly expressed in squamous epithelia, where it plays a crucial role in the signal
Probab=90.70  E-value=0.12  Score=46.38  Aligned_cols=29  Identities=14%  Similarity=0.060  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|||+++.|||
T Consensus       100 ~~~~ql~~~L~~lH~~~ivH~dlkp~NIl  128 (320)
T cd05590         100 FYAAEITSALMFLHDKGIIYRDLKLDNVL  128 (320)
T ss_pred             HHHHHHHHHHHHHHHCCeEeCCCCHHHeE
Confidence            34578999999999999999999999996


No 97 
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1. Serine/Threonine Kinases (STKs), ROCK subfamily, ROCK1 (or ROK-beta) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ROCK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. ROCK contains an N-terminal extension, a catalytic kinase domain, and a C-terminal extension, which contains a coiled-coil region encompassing a Rho-binding domain (RBD) and a pleckstrin homology (PH) domain. ROCK is auto-inhibited by the RBD and PH domain interacting with the catalytic domain, and is activated via interaction with Rho GTPases. ROCK1 is preferentially expressed in the liver, lung, spleen, testes, an
Probab=90.66  E-value=0.11  Score=48.03  Aligned_cols=28  Identities=4%  Similarity=0.158  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|+.|||
T Consensus       147 ~~~qi~~aL~~LH~~~ivHrDLkp~NIl  174 (371)
T cd05622         147 YTAEVVLALDAIHSMGFIHRDVKPDNML  174 (371)
T ss_pred             HHHHHHHHHHHHHHCCEEeCCCCHHHEE
Confidence            3468999999999999999999999996


No 98 
>KOG0578 consensus p21-activated serine/threonine protein kinase [Signal transduction mechanisms]
Probab=90.63  E-value=0.092  Score=53.68  Aligned_cols=35  Identities=17%  Similarity=0.186  Sum_probs=29.0

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      -+|--.-.++|+.+|++||++.|||||+|+-+||.
T Consensus       368 E~qIA~Icre~l~aL~fLH~~gIiHrDIKSDnILL  402 (550)
T KOG0578|consen  368 EGQIAAICREILQGLKFLHARGIIHRDIKSDNILL  402 (550)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcceeeeccccceeEe
Confidence            34444456778899999999999999999999975


No 99 
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase. Serine/Threonine Kinases (STKs), 90 kDa ribosomal protein S6 kinase (RSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. RSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family. They are activated by signaling inputs from extracellular regulated kinase (ERK) and phosphoinositide dependent kinase 1 (PDK1). ERK phosphorylates and activates the CTD of RSK, serving as a docking site for PDK1, which phosphorylates and activates the NTD, which in turn phosphorylate
Probab=90.61  E-value=0.12  Score=45.98  Aligned_cols=28  Identities=11%  Similarity=0.031  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       103 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  130 (318)
T cd05582         103 YLAELALALDHLHSLGIIYRDLKPENIL  130 (318)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHeE
Confidence            3468999999999999999999999986


No 100
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional
Probab=90.54  E-value=0.12  Score=47.26  Aligned_cols=29  Identities=10%  Similarity=0.041  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||.++.|||
T Consensus       135 ~~~~qi~~aL~~LH~~~ivHrDLkp~NIL  163 (340)
T PTZ00426        135 FYAAQIVLIFEYLQSLNIVYRDLKPENLL  163 (340)
T ss_pred             HHHHHHHHHHHHHHHCCeEccCCCHHHEE
Confidence            34678999999999999999999999997


No 101
>PHA03211 serine/threonine kinase US3; Provisional
Probab=90.50  E-value=0.12  Score=50.61  Aligned_cols=28  Identities=4%  Similarity=0.156  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|+|++|||
T Consensus       265 i~~qi~~aL~yLH~~gIvHrDLKP~NIL  292 (461)
T PHA03211        265 VARQLLSAIDYIHGEGIIHRDIKTENVL  292 (461)
T ss_pred             HHHHHHHHHHHHHHCCEEECcCCHHHEE
Confidence            3467889999999999999999999986


No 102
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3. Protein Tyrosine Kinase (PTK) family; Janus kinase 2 (Jak2) and Jak3; catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak2 and Jak3 are members of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal catalytic tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as th
Probab=90.45  E-value=0.13  Score=44.28  Aligned_cols=30  Identities=13%  Similarity=0.121  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       111 ~~~~~~l~~aL~~LH~~~i~H~dlkp~nil  140 (284)
T cd05081         111 LLYASQICKGMEYLGSKRYVHRDLATRNIL  140 (284)
T ss_pred             HHHHHHHHHHHHHHHHCCceeccCCHhhEE
Confidence            344578999999999999999999999985


No 103
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2. Serine/Threonine Kinases (STKs), NDR kinase subfamily, NDR2 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. Both isoforms play a role in proper centrosome duplication. In addition, NDR2 plays a role in regul
Probab=90.40  E-value=0.12  Score=46.92  Aligned_cols=28  Identities=0%  Similarity=0.044  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       106 ~~~qi~~~L~~lH~~givHrDLkp~NIl  133 (360)
T cd05627         106 YIAETVLAIDAIHQLGFIHRDIKPDNLL  133 (360)
T ss_pred             HHHHHHHHHHHHHHCCeEccCCCHHHEE
Confidence            4578999999999999999999999996


No 104
>KOG0664 consensus Nemo-like MAPK-related serine/threonine protein kinase [Signal transduction mechanisms]
Probab=90.39  E-value=0.1  Score=50.77  Aligned_cols=28  Identities=11%  Similarity=0.126  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +--+|+.+|||||+..|.|||+|+.|+|
T Consensus       161 FlYQILRGLKYLHsA~ILHRDIKPGNLL  188 (449)
T KOG0664|consen  161 FVYQILRGLKYLHTANILHRDIKPGNLL  188 (449)
T ss_pred             hHHHHHhhhHHHhhcchhhccCCCccEE
Confidence            4579999999999999999999998854


No 105
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins. Serine/Threonine Kinases (STKs), RPK118-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The RPK118-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily show similarity to human RPK118, which contains an N-terminal Phox homology (PX) domain, a Microtubule Interacting and Trafficking (MIT) domain, and a kinase domain containing a long insert. Also included in the family is human RPK60 (or ribosomal protein S6 kinase-like 1), which also contains MIT and kinase domains but lacks a PX domain. RPK118 binds sphingosine kinase, a key enzyme in the synthesis of sphingosine 1-phospha
Probab=90.39  E-value=0.13  Score=43.65  Aligned_cols=31  Identities=10%  Similarity=0.133  Sum_probs=27.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+...+|+.+|.+||++.|+|+|.++.||+
T Consensus        87 ~~~~~~ql~~~l~~lH~~~i~H~dlkp~Nil  117 (237)
T cd05576          87 VKRWAAEMVVALDALHREGIVCRDLNPNNIL  117 (237)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3455678999999999999999999999986


No 106
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Colony-Stimulating Factor-1 Receptor (CSF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. CSF-1R, also called c-Fms, is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of CSF-1R to its ligand, CSF-1, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. CSF-1R signaling is criti
Probab=90.31  E-value=0.12  Score=47.97  Aligned_cols=29  Identities=14%  Similarity=0.120  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-..+|+.+|.+||++.|+|||.+++|||
T Consensus       216 ~i~~qi~~aL~yLH~~giiHrDLkp~Nil  244 (374)
T cd05106         216 RFSSQVAQGMDFLASKNCIHRDVAARNVL  244 (374)
T ss_pred             HHHHHHHHHHHHHHHCCEEeccCchheEE
Confidence            44578999999999999999999999986


No 107
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA10 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchor
Probab=90.25  E-value=0.12  Score=44.38  Aligned_cols=31  Identities=16%  Similarity=0.169  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~~~~~~~i~~al~~lH~~~iiH~dikp~nil  139 (266)
T cd05064         109 LMGMLPGLASGMKYLSEMGYVHKGLAAHKVL  139 (266)
T ss_pred             HHHHHHHHHHHHHHHHHCCEeeccccHhhEE
Confidence            3455678999999999999999999999986


No 108
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 5 (CDKL5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Mutations in the gene encoding CDKL5, previously called STK9, are associated with early onset epilepsy and severe mental retardation [X-linked infantile spasm syndrome (ISSX) or West syndrome]. In addition, CDKL5 mutations also sometimes 
Probab=90.23  E-value=0.14  Score=44.22  Aligned_cols=29  Identities=7%  Similarity=0.082  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 ~~~~qi~~~L~~lH~~~i~H~dlkp~Nil  132 (287)
T cd07848         104 SYIYQLIKAIHWCHKNDIVHRDIKPENLL  132 (287)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999986


No 109
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. 
Probab=90.19  E-value=0.14  Score=45.77  Aligned_cols=28  Identities=4%  Similarity=0.051  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||.+.|+|+|.++.|||
T Consensus       106 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  133 (333)
T cd05600         106 YMAEMFEAVDALHELGYIHRDLKPENFL  133 (333)
T ss_pred             HHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            4578999999999999999999999996


No 110
>KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms]
Probab=90.19  E-value=0.12  Score=49.61  Aligned_cols=30  Identities=10%  Similarity=0.121  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhcccc-ccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQT-MTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~-i~~~d~~~a~i~  252 (264)
                      ....-+|..+++|||++. |||||.|+.|||
T Consensus       145 l~~aldiArGm~YLH~~~~iIHrDLK~~NiL  175 (362)
T KOG0192|consen  145 LRIALDIARGMEYLHSEGPIIHRDLKSDNIL  175 (362)
T ss_pred             HHHHHHHHHHHHHHhcCCCeeecccChhhEE
Confidence            355568889999999999 999999999997


No 111
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Myotonic Dystrophy protein kinase (DMPK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The DMPK-like subfamily is composed of DMPK and DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK). Three isoforms of MRCK are known, named alpha, beta and gamma. The DMPK gene is implicated in myotonic dystrophy 1 (DM1), an inherited multisystemic disorder with symptoms that include muscle hyperexcitability, progressive muscle weakness and wasting, cataract development, testicular atrophy,
Probab=90.18  E-value=0.14  Score=46.23  Aligned_cols=28  Identities=0%  Similarity=0.054  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.++.|||
T Consensus       107 ~~~qi~~~l~~lH~~~ivH~dlkp~Nil  134 (331)
T cd05597         107 YLAEMVLAIDSVHQLGYVHRDIKPDNVL  134 (331)
T ss_pred             HHHHHHHHHHHHHhCCeEECCCCHHHEE
Confidence            4578999999999999999999999985


No 112
>cd05074 PTKc_Tyro3 Catalytic domain of the Protein Tyrosine Kinase, Tyro3. Protein Tyrosine Kinase (PTK) family; Tyro3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyro3 (or Sky) is a member of the Axl subfamily, which is composed of receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Tyro3 is predominantly expressed in the central nervous system and the brain, and functions as a neurotrophic fac
Probab=90.16  E-value=0.13  Score=43.78  Aligned_cols=31  Identities=19%  Similarity=0.073  Sum_probs=27.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .....+|+.+|.+||+..|+|+|.+++|||-
T Consensus       116 ~~~~~~i~~~l~~lH~~~i~H~dikp~nili  146 (273)
T cd05074         116 VRFMIDIASGMEYLSSKNFIHRDLAARNCML  146 (273)
T ss_pred             HHHHHHHHHHHHHHHhCCEeecccchhhEEE
Confidence            3445789999999999999999999999873


No 113
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Axl subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The Axl subfamily consists of Axl, Tyro3 (or Sky), Mer (or Mertk), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Axl subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with two immunoglobulin-like domains followed by two fibronectin type III repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, Gas6 and protein S, leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Axl subfamily members are implicated in a variety of cellu
Probab=90.16  E-value=0.13  Score=43.57  Aligned_cols=28  Identities=18%  Similarity=0.086  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       118 ~~~~i~~aL~~lH~~~i~H~dlkp~Nil  145 (273)
T cd05035         118 FMVDIALGMEYLSNRNFIHRDLAARNCM  145 (273)
T ss_pred             HHHHHHHHHHHHHhCCeeccccchheEE
Confidence            3478999999999999999999999986


No 114
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N. Serine/Threonine Kinases (STKs), Protein Kinase N (PKN) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKN subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKN has a C-terminal catalytic domain that is highly homologous to PKCs. Its unique N-terminal regulatory region contains antiparallel coiled-coil (ACC) domains. In mammals, there are three PKN isoforms from different genes (designated PKN-alpha, beta, and gamma), which show different enzymatic properties, tissue distribution, and varied functions. PKN can be activated by the small GTPase Rho, and by fatty acids such as arachidonic and linoleic acids. It is involved 
Probab=90.11  E-value=0.14  Score=45.82  Aligned_cols=31  Identities=10%  Similarity=0.127  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|++||++.|+|||.++.|||
T Consensus       103 ~~~~~~qi~~al~~lH~~~ivHrdlkp~Nil  133 (324)
T cd05589         103 AVFYAACVVLGLQYLHENKIVYRDLKLDNLL  133 (324)
T ss_pred             HHHHHHHHHHHHHHHHhCCeEecCCCHHHeE
Confidence            3345678999999999999999999999985


No 115
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) beta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKbeta is expressed ubiquitously in many tissues.
Probab=90.02  E-value=0.13  Score=46.28  Aligned_cols=27  Identities=0%  Similarity=0.115  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.|+.|||
T Consensus       108 ~~qi~~~L~~lH~~~iiHrDlkp~Nil  134 (331)
T cd05624         108 IAEMVLAIHSIHQLHYVHRDIKPDNVL  134 (331)
T ss_pred             HHHHHHHHHHHHHCCeeeccCchHHEE
Confidence            468999999999999999999999986


No 116
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK3 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK3 (also known as beta-adrenergic receptor kinase 2) is wi
Probab=90.02  E-value=0.14  Score=44.66  Aligned_cols=29  Identities=24%  Similarity=0.192  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.|||
T Consensus       101 ~i~~qi~~al~~lH~~~ivH~dikp~Nil  129 (279)
T cd05633         101 FYATEIILGLEHMHNRFVVYRDLKPANIL  129 (279)
T ss_pred             HHHHHHHHHHHHHHHCCcCCCCCCHHHEE
Confidence            34578999999999999999999999986


No 117
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C. Serine/Threonine Kinases (STKs), Protein Kinase C (PKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, classical PKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. Novel PKCs are calcium-independent, but require DAG and PS for activity, while atypical PKCs only re
Probab=90.00  E-value=0.15  Score=45.55  Aligned_cols=29  Identities=10%  Similarity=0.067  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.++.|||
T Consensus       100 ~~~~qi~~~l~~LH~~~ivH~dlkp~Nil  128 (318)
T cd05570         100 FYAAEIVLGLQFLHERGIIYRDLKLDNVL  128 (318)
T ss_pred             HHHHHHHHHHHHHHhCCeEccCCCHHHeE
Confidence            34578999999999999999999999987


No 118
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, iota isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-iota is directly implicated in carcinogenesis. It is critical to oncogenic signaling mediated by Ras and Bcr-Abl. The PKC-iota gene is the target o
Probab=89.97  E-value=0.15  Score=46.13  Aligned_cols=29  Identities=14%  Similarity=0.031  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|||+++.|||
T Consensus       100 ~i~~qi~~~l~~lH~~~ivH~Dikp~Nil  128 (329)
T cd05618         100 FYSAEISLALNYLHERGIIYRDLKLDNVL  128 (329)
T ss_pred             HHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            34568999999999999999999999986


No 119
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha. Serine/Threonine Kinases (STKs), DMPK-like subfamily, DMPK-related cell division control protein 42 (Cdc42) binding kinase (MRCK) alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The DMPK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MRCK is activated via interaction with the small GTPase Cdc42. MRCK/Cdc42 signaling mediates myosin-dependent cell motility. MRCKalpha is expressed ubiquitously in many tissues. It plays a role in the regulation of peripheral actin reorganization and neurite outgrowth. It may also play a role in the transferrin iron uptake pathw
Probab=89.94  E-value=0.14  Score=46.09  Aligned_cols=28  Identities=4%  Similarity=0.077  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|+.|||
T Consensus       107 ~~~qi~~al~~lH~~~iiHrDlkp~Nil  134 (332)
T cd05623         107 YLAEMVIAIDSVHQLHYVHRDIKPDNIL  134 (332)
T ss_pred             HHHHHHHHHHHHHHCCeEecCCCHHHEE
Confidence            3468999999999999999999999986


No 120
>KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only]
Probab=89.93  E-value=0.14  Score=49.39  Aligned_cols=29  Identities=10%  Similarity=0.088  Sum_probs=27.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...||+.+|.+||+..|+|||.|+.|||
T Consensus       124 ~~m~Qll~gl~~~H~~~IlHRDLKPQNlL  152 (323)
T KOG0594|consen  124 SFMRQLLRGLAFLHSHGILHRDLKPQNLL  152 (323)
T ss_pred             HHHHHHHHHHHHHHhCCeecccCCcceEE
Confidence            55689999999999999999999999996


No 121
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta. Serine/Threonine Kinases (STKs), Novel Protein Kinase C (nPKC), theta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The nPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. nPKCs are calcium-independent, but require DAG (1,2-diacylglycerol) and phosphatidylserine (PS) for activity. There are four nPKC isoforms, delta, epsilon, eta, and theta. PKC-theta is selectively expressed in T-cells and plays an important and non-redundant role in 
Probab=89.93  E-value=0.15  Score=45.75  Aligned_cols=28  Identities=18%  Similarity=0.157  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||+++.|||
T Consensus       101 ~~~qi~~al~~LH~~~ivHrdikp~Nil  128 (316)
T cd05619         101 YAAEIICGLQFLHSKGIVYRDLKLDNIL  128 (316)
T ss_pred             HHHHHHHHHHHHHhCCeEeCCCCHHHEE
Confidence            4578999999999999999999999996


No 122
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3. Protein Tyrosine Kinase (PTK) family; HER3 (ErbB3); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER3 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr r
Probab=89.90  E-value=0.13  Score=44.58  Aligned_cols=28  Identities=21%  Similarity=0.190  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++|||
T Consensus       114 i~~qi~~~l~~lH~~~iiH~dlkp~nil  141 (279)
T cd05111         114 WCVQIAKGMYYLEEHRMVHRNLAARNIL  141 (279)
T ss_pred             HHHHHHHHHHHHHHCCEeccccCcceEE
Confidence            4468999999999999999999999986


No 123
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family, catalytic domain. This PTKc family is part of a larger superfamily that includes the catalytic domains of protein serine/threonine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. They can be classified into receptor and non-receptor tyr kinases. PTKs play important roles in many cellular processes including, lymphocyte activation, epithelium growth and maintenance, metabolism control, organogenesis regulation, survival, proliferation, differentiation, migration, adhesion, motility, and morphogenesis. Receptor tyr kinases (RTKs) are integral membrane proteins which contain an extracellular ligand-binding region, a transmembrane segment, and an intracellular tyr kinase domain. RTKs are usually activated through ligan
Probab=89.88  E-value=0.15  Score=42.27  Aligned_cols=30  Identities=17%  Similarity=0.129  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~~~~l~~al~~lH~~~i~H~di~p~nil  137 (262)
T cd00192         108 LSFAIQIAKGMEYLASKKFVHRDLAARNCL  137 (262)
T ss_pred             HHHHHHHHHHHHHHHcCCcccCccCcceEE
Confidence            345578999999999999999999999986


No 124
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, zeta isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. There are two aPKC isoforms, zeta and iota. PKC-zeta plays a critical role in activating the glucose transport response. It is activated by glucose, insulin, and exercise through diverse pathways
Probab=89.77  E-value=0.16  Score=45.75  Aligned_cols=29  Identities=10%  Similarity=0.016  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       100 ~~~~qi~~al~~lH~~~ivHrDlkp~Nil  128 (327)
T cd05617         100 FYAAEICIALNFLHERGIIYRDLKLDNVL  128 (327)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            34578999999999999999999999986


No 125
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase 2 (Tyk2); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tyk2 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of sign
Probab=89.76  E-value=0.13  Score=44.30  Aligned_cols=29  Identities=17%  Similarity=0.102  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       111 ~i~~~l~~~l~~lH~~~i~H~dlkp~Nil  139 (283)
T cd05080         111 LFAQQICEGMAYLHSQHYIHRDLAARNVL  139 (283)
T ss_pred             HHHHHHHHHHHHHHHCCeeccccChheEE
Confidence            34568999999999999999999999987


No 126
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyclin A complex controls G2
Probab=89.70  E-value=0.16  Score=43.49  Aligned_cols=30  Identities=7%  Similarity=-0.015  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.|||
T Consensus       104 ~~~~~qi~~~L~~lH~~~i~H~dl~p~nil  133 (285)
T cd07861         104 KSYLYQILQGILFCHSRRVLHRDLKPQNLL  133 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecCCCHHHEE
Confidence            345689999999999999999999999985


No 127
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR) subfamily; catalytic (c) domain. The DDR subfamily consists of homologs of mammalian DDR1, DDR2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR subfamily members are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linke
Probab=89.66  E-value=0.16  Score=43.92  Aligned_cols=27  Identities=22%  Similarity=0.218  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.+++|||
T Consensus       136 ~~~i~~al~~LH~~~i~H~dlkp~Nil  162 (296)
T cd05051         136 ATQIASGMRYLESLNFVHRDLATRNCL  162 (296)
T ss_pred             HHHHHHHHHHHHHcCccccccchhcee
Confidence            468999999999999999999999987


No 128
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1. Protein Tyrosine Kinase (PTK) family; Tie1; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie1 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. No specific ligand has been identified for Tie1, although the angiopoietin, Ang-1, binds to Tie1 through integrins at high concentrations.
Probab=89.64  E-value=0.15  Score=44.75  Aligned_cols=28  Identities=11%  Similarity=0.179  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|+|+++.|||
T Consensus       124 i~~qi~~al~~lH~~~ivH~dlkp~Nil  151 (297)
T cd05089         124 FASDVATGMQYLSEKQFIHRDLAARNVL  151 (297)
T ss_pred             HHHHHHHHHHHHHHCCcccCcCCcceEE
Confidence            4468999999999999999999999985


No 129
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha. Serine/Threonine Kinases (STKs), Protein Kinase B (PKB) or Akt subfamily, alpha (or Akt1) isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. There are three PKB isoforms from different genes, PKB-alpha (or Akt1), PKB-beta (or Akt2), and PKB-gamma (or Akt3). PKB contains an N-terminal pleckstrin homology (PH) domain and a C-terminal catalytic domain. PKB-alpha is predominantly expressed in endothelial cells. It is critical for the regulation of angiogenesis and the maintenance of vascular integrity. It also plays a role in adipocyte differentiation. Mice deficien
Probab=89.64  E-value=0.14  Score=45.74  Aligned_cols=28  Identities=14%  Similarity=0.170  Sum_probs=24.9

Q ss_pred             hhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+ +.|+|+|+++.|||
T Consensus       100 ~~~qi~~aL~~lH~~~~ivHrDikp~NIl  128 (325)
T cd05594         100 YGAEIVSALDYLHSEKNVVYRDLKLENLM  128 (325)
T ss_pred             HHHHHHHHHHHHHhcCCEEecCCCCCeEE
Confidence            34689999999997 79999999999995


No 130
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. This subfamily is composed of RIO1 proteins from eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle progression and c
Probab=89.61  E-value=0.17  Score=43.42  Aligned_cols=28  Identities=14%  Similarity=0.102  Sum_probs=24.7

Q ss_pred             hhHHHHHHhhhh-ccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGL-QNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l-~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+..|.+| |+..|+|||.|++|||
T Consensus       122 i~~qi~~~L~~l~H~~giiHrDlkP~NIl  150 (190)
T cd05147         122 LYLQVIQIMRILYQDCRLVHADLSEYNLL  150 (190)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            346788999999 7999999999999996


No 131
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein. Protein Kinase family, STE20-related kinase adapter protein (STRAD) subfamily, pseudokinase domain. The STRAD subfamily is part of a larger superfamily that includes the catalytic domains of serine/threonine kinases (STKs), protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The pseudokinase domain shows similarity to protein kinases but lacks crucial residues for catalytic activity. STRAD forms a complex with the scaffolding protein MO25, and the STK, LKB1, resulting in the activation of the kinase. In the complex, LKB1 phosphorylates and activates adenosine monophosphate-activated protein kinases (AMPKs), which regulate cell energy metabolism and cell polarity. LKB1 is a tumor suppressor linked to the rare inherited disease, Peutz-Jeghers syndrome, which is characterized by a predisposition to benign polyps and hyperpigmentation of the buc
Probab=89.61  E-value=0.14  Score=44.77  Aligned_cols=28  Identities=11%  Similarity=0.164  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++.||+
T Consensus       106 ~~~~l~~~L~~LH~~~ivH~dlk~~Nil  133 (314)
T cd08216         106 ILKDVLNALDYIHSKGFIHRSVKASHIL  133 (314)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCcceEE
Confidence            3468999999999999999999999986


No 132
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes. Protein Tyrosine Kinase (PTK) family; Fes (or Fps) kinase subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr kinase activity. Fes kinase is expressed in myeloid, vascular 
Probab=89.54  E-value=0.17  Score=42.67  Aligned_cols=30  Identities=10%  Similarity=0.059  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus        97 ~~~~~qi~~~L~~lH~~~i~H~dl~p~nil  126 (252)
T cd05084          97 IQMVENAAAGMEYLESKHCIHRDLAARNCL  126 (252)
T ss_pred             HHHHHHHHHHHHHHHhCCccccccchheEE
Confidence            345578999999999999999999999975


No 133
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK5 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK5 is widely expressed in many tissues. It associates with
Probab=89.54  E-value=0.16  Score=44.27  Aligned_cols=30  Identities=13%  Similarity=0.168  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~~ql~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05632         105 LFYAAEILCGLEDLHRENTVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecCCCHHHEE
Confidence            345578999999999999999999999987


No 134
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor (FGFR) subfamily; catalytic (c) domain. The FGFR subfamily consists of FGFR1, FGFR2, FGFR3, FGFR4, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K).PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, and to heparin/heparan sulfate (HS) results in the formation of a ternary complex, which leads to receptor dimerization and activation, 
Probab=89.50  E-value=0.13  Score=44.41  Aligned_cols=28  Identities=11%  Similarity=0.059  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|+|.+++|||
T Consensus       137 i~~qi~~al~~LH~~~ivH~dlkp~Nil  164 (293)
T cd05053         137 FAYQVARGMEFLASKKCIHRDLAARNVL  164 (293)
T ss_pred             HHHHHHHHHHHHHHCCccccccceeeEE
Confidence            4568999999999999999999999985


No 135
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase. Protein Tyrosine Kinase (PTK) family; Abelson (Abl) kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Abl (or c-Abl) is a ubiquitously-expressed cytoplasmic (or nonreceptor) tyr kinase that contains SH3, SH2, and tyr kinase domains in its N-terminal region, as well as nuclear localization motifs, a putative DNA-binding domain, and F- and G-actin binding domains in its C-terminal tail. It also contains a short autoinhibitory cap region in its N-terminus. Abl is normally inactive and requires phosphorylation and myristoylation for activation. Abl function depends on its subcellular localization. In the cytoplasm, Abl plays
Probab=89.40  E-value=0.15  Score=43.44  Aligned_cols=28  Identities=21%  Similarity=0.185  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       109 ~~~ql~~~l~~lH~~~i~H~dlkp~nil  136 (263)
T cd05052         109 MATQISSAMEYLEKKNFIHRDLAARNCL  136 (263)
T ss_pred             HHHHHHHHHHHHHhCCEeecccCcceEE
Confidence            3578999999999999999999999987


No 136
>PF00069 Pkinase:  Protein kinase domain Protein kinase; unclassified specificity. Serine/Threonine protein kinases, catalytic domain Tyrosine kinase, catalytic domain;  InterPro: IPR017442 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Eukaryotic protein kinases [, , , , ] are enzymes that belong to a very extensive family of proteins which share a conserved catalytic core common with both serine/threonine and tyrosine protein kinases. There are a number of conserved regions in the catalytic domain of protein kinases. In the N-terminal extremity of the catalytic domain there is a glycine-rich stretch of residues in the vicinity of a lysine residue, which has been shown to be involved in ATP binding. In the central part of the catalytic domain there is a conserved aspartic acid residue which is important for the catalytic activity of the enzyme []. This entry includes protein kinases from eukaryotes and viruses and may include some bacterial hits too.; GO: 0004672 protein kinase activity, 0005524 ATP binding, 0006468 protein phosphorylation; PDB: 3GC7_A 3ZYA_A 3MPT_A 3NEW_A 3MVM_A 1R3C_A 2FST_X 3E93_A 3HV5_B 3OCG_A ....
Probab=89.37  E-value=0.17  Score=42.28  Aligned_cols=30  Identities=13%  Similarity=0.174  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|+++.||+
T Consensus       101 ~~~~~qi~~~L~~Lh~~~i~H~dikp~NIl  130 (260)
T PF00069_consen  101 LKIAYQILEALAYLHSKGIVHRDIKPENIL  130 (260)
T ss_dssp             HHHHHHHHHHHHHHHHTTEEESSBSGGGEE
T ss_pred             cccccccccccccccccccccccccccccc
Confidence            344578999999999999999999999996


No 137
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase C (TrkC); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkC is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkC to its ligand, neurotrophin 3 (NT3), results in receptor oligomerization and activation of the catalytic domain. TrkC is broadly expressed in the nervous system and in some n
Probab=89.27  E-value=0.16  Score=44.29  Aligned_cols=30  Identities=17%  Similarity=0.120  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       126 ~~i~~~i~~al~~lH~~~i~H~dlkp~Nil  155 (291)
T cd05094         126 LHIASQIASGMVYLASQHFVHRDLATRNCL  155 (291)
T ss_pred             HHHHHHHHHHHHHHHhCCeeecccCcceEE
Confidence            344578999999999999999999999986


No 138
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor (Ror) subfamily; catalytic (c) domain. The Ror subfamily consists of Ror1, Ror2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimer
Probab=89.22  E-value=0.16  Score=43.49  Aligned_cols=28  Identities=14%  Similarity=0.108  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.+++||+
T Consensus       129 ~~~~l~~al~~lH~~~i~H~dlkp~Nil  156 (283)
T cd05048         129 IAIQIAAGMEYLSSHHFVHRDLAARNCL  156 (283)
T ss_pred             HHHHHHHHHHHHHhCCeeccccccceEE
Confidence            4578999999999999999999999986


No 139
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase. Serine/Threonine Kinases (STKs), Plant B-type Cyclin-Dependent protein Kinase (CdkB) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CdkB subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. The plant-specific B-type CDKs are expressed from the late S to the M phase of the cell cycle. They are characterized by the cyclin binding motif PPT[A/T]LRE. They play a role in controlling mitosis and integrating developm
Probab=89.21  E-value=0.18  Score=43.50  Aligned_cols=32  Identities=3%  Similarity=-0.014  Sum_probs=27.7

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|++.++.||+
T Consensus       111 ~~~~~~~qi~~~L~~LH~~~i~H~dl~~~nil  142 (295)
T cd07837         111 TIKSFMYQLLKGVAHCHKHGVMHRDLKPQNLL  142 (295)
T ss_pred             HHHHHHHHHHHHHHHHHHCCeeecCCChHHEE
Confidence            33455678999999999999999999999985


No 140
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C. Serine/Threonine Kinases (STKs), Atypical Protein Kinase C (aPKC) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The aPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. aPKCs only require phosphatidylserine (PS) for activation. They contain a C2-like region, instead of a calcium-binding (C2) region found in classical PKCs, in their regulatory domain. There are two aPKC isoforms, zeta and iota. aPKCs are involved in many cellular functions incl
Probab=89.15  E-value=0.19  Score=45.32  Aligned_cols=29  Identities=14%  Similarity=0.017  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|||.++.|||
T Consensus       100 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  128 (329)
T cd05588         100 FYSAEISLALNFLHERGIIYRDLKLDNVL  128 (329)
T ss_pred             HHHHHHHHHHHHHHHCCeEecCCCHHHeE
Confidence            44578999999999999999999999986


No 141
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 5 (CDK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK5 is unusual in that it is regulated by non-cyclin proteins, p35 and p39. It is highly expressed in the nervous system and is critical in normal neural development and function. It plays a role in neuronal migration and differentiation, and is also
Probab=89.11  E-value=0.19  Score=43.13  Aligned_cols=32  Identities=6%  Similarity=-0.035  Sum_probs=27.8

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..+...+|+.+|.+||++.|+|+|.++.||+
T Consensus       100 ~~~~~~~qi~~al~~LH~~~i~H~dl~~~nil  131 (284)
T cd07839         100 IVKSFMFQLLKGLAFCHSHNVLHRDLKPQNLL  131 (284)
T ss_pred             HHHHHHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            33456688999999999999999999999985


No 142
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 2 (FGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR2 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=89.09  E-value=0.17  Score=44.39  Aligned_cols=28  Identities=14%  Similarity=0.105  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|.++.|||
T Consensus       142 ~~~qi~~al~~LH~~givH~dlkp~Nil  169 (304)
T cd05101         142 CTYQVARGMEYLASQKCIHRDLAARNVL  169 (304)
T ss_pred             HHHHHHHHHHHHHHCCeeecccccceEE
Confidence            3568999999999999999999999986


No 143
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk catalyzes the tyr phosphorylation of the regulatory C-terminal tail of Src kinases, re
Probab=89.08  E-value=0.17  Score=42.94  Aligned_cols=28  Identities=14%  Similarity=0.143  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.+++||+
T Consensus       107 ~~~~i~~~l~~lH~~~i~H~dlkp~nil  134 (256)
T cd05082         107 FSLDVCEAMEYLEANNFVHRDLAARNVL  134 (256)
T ss_pred             HHHHHHHHHHHHHhCCEeccccchheEE
Confidence            3468899999999999999999999986


No 144
>PTZ00267 NIMA-related protein kinase; Provisional
Probab=89.06  E-value=0.17  Score=48.80  Aligned_cols=28  Identities=18%  Similarity=0.165  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||+|+.|||
T Consensus       174 i~~qi~~aL~~lH~~~ivHrDlkp~NIl  201 (478)
T PTZ00267        174 LFYQIVLALDEVHSRKMMHRDLKSANIF  201 (478)
T ss_pred             HHHHHHHHHHHHHhCCEEECCcCHHhEE
Confidence            3468999999999999999999999995


No 145
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase B (TrkB); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkB is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkB to its ligands, brain-derived neurotrophic factor (BDNF) or neurotrophin 4 (NT4), results in receptor oligomerization and activation of the catalytic domain. TrkB is broadly 
Probab=89.06  E-value=0.18  Score=43.93  Aligned_cols=31  Identities=13%  Similarity=0.073  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.+++|||
T Consensus       122 ~~~~~~ql~~aL~~lH~~~i~H~dlkp~Nil  152 (288)
T cd05093         122 MLHIAQQIAAGMVYLASQHFVHRDLATRNCL  152 (288)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeecccCcceEE
Confidence            3445678999999999999999999999986


No 146
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase. Protein Tyrosine Kinase (PTK) family; Spleen tyrosine kinase (Syk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk, together with Zap-70, form the Syk subfamily of kinases which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Syk was first cloned from the spleen, and its function in hematopoietic cells is well-established. Syk is involved in the signaling downstream of activated receptors (including B-cell and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferatio
Probab=89.03  E-value=0.18  Score=42.85  Aligned_cols=29  Identities=10%  Similarity=0.125  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus        99 ~i~~qi~~al~~lH~~~i~H~dlkp~nil  127 (257)
T cd05116          99 ELVHQVSMGMKYLEETNFVHRDLAARNVL  127 (257)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccchhhEE
Confidence            34568999999999999999999999986


No 147
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase. Serine/threonine kinases (STKs), Apoptosis signal-regulating kinase (ASK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ASK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Subfamily members are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) and include ASK1, ASK2, and MAPKKK15. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. ASK1 (also called MAPKKK5) functions in the c-Jun N-terminal kina
Probab=88.98  E-value=0.2  Score=42.79  Aligned_cols=28  Identities=11%  Similarity=0.237  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|++.+++||+
T Consensus       113 ~~~qi~~al~~lH~~~i~h~dl~p~nil  140 (268)
T cd06624         113 YTKQILEGLKYLHDNQIVHRDIKGDNVL  140 (268)
T ss_pred             HHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            3468999999999999999999999987


No 148
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 5, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK5 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK5 is mainly express
Probab=88.97  E-value=0.2  Score=44.17  Aligned_cols=29  Identities=17%  Similarity=0.232  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       122 ~~~~qi~~~l~~LH~~~ivH~dlkp~Nil  150 (292)
T cd06658         122 TVCLSVLRALSYLHNQGVIHRDIKSDSIL  150 (292)
T ss_pred             HHHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            45578999999999999999999999986


No 149
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1. Serine/Threonine Kinases (STKs), Cell Division Cycle 2-like 1 (CDC2L1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDC2L1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDC2L1, also called PITSLRE, exists in different isoforms which are named using the alias CDK11(p). The CDC2L1 gene produces two protein products, CDK11(p110) and CDK11(p58). CDC2L1 is also represented by the caspase-processed CDK11(p46). CDK11(p110), the
Probab=88.95  E-value=0.19  Score=43.57  Aligned_cols=31  Identities=6%  Similarity=0.073  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.|||
T Consensus       108 ~~~i~~qi~~aL~~LH~~~i~H~dl~p~nil  138 (293)
T cd07843         108 VKCLMLQLLSGVAHLHDNWILHRDLKTSNLL  138 (293)
T ss_pred             HHHHHHHHHHHHHHHHHCCeeeccCCHHHEE
Confidence            3345578999999999999999999999985


No 150
>PTZ00283 serine/threonine protein kinase; Provisional
Probab=88.95  E-value=0.19  Score=49.21  Aligned_cols=28  Identities=11%  Similarity=0.152  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|++|||
T Consensus       148 i~~qll~aL~~lH~~~IiHrDLKP~NIL  175 (496)
T PTZ00283        148 LFIQVLLAVHHVHSKHMIHRDIKSANIL  175 (496)
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            3468999999999999999999999985


No 151
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase. Serine/Threonine Kinases (STKs), PFTAIRE-2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PFTAIRE-2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PFTAIRE-2 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PFTAIRE-2 is also referred to as ALS2CR7 (amyotrophic lateral sclerosis 2 (juvenile) chromosome region candidate 7). It may be associated with amyotrophic lateral sclerosis 2 (ALS2), an autosomal recess
Probab=88.94  E-value=0.22  Score=43.15  Aligned_cols=29  Identities=7%  Similarity=0.037  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       107 ~~~~qi~~~L~~lH~~~i~H~dlkp~Nil  135 (291)
T cd07870         107 LFMFQLLRGLAYIHGQHILHRDLKPQNLL  135 (291)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChHHEE
Confidence            34578999999999999999999999986


No 152
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha. Serine/Threonine Kinases (STKs), Classical Protein Kinase C (cPKC) subfamily, alpha isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cPKC subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PKCs are classified into three groups (classical, atypical, and novel) depending on their mode of activation and the structural characteristics of their regulatory domain. PKCs undergo three phosphorylations in order to take mature forms. In addition, cPKCs depend on calcium, DAG (1,2-diacylglycerol), and in most cases, phosphatidylserine (PS) for activation. There are four cPKC isoforms, named alpha, betaI, betaII, a
Probab=88.92  E-value=0.2  Score=45.03  Aligned_cols=30  Identities=13%  Similarity=0.009  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|+++.|||
T Consensus       104 ~~i~~qi~~al~~lH~~~ivHrDikp~Nil  133 (323)
T cd05615         104 VFYAAEISVGLFFLHRRGIIYRDLKLDNVM  133 (323)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            344578999999999999999999999985


No 153
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase A (TrkA); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. TrkA is a member of the Trk subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding of TrkA to its ligand, nerve growth factor (NGF), results in receptor oligomerization and activation of the catalytic domain. TrkA is expressed mainly in neural-crest-derived sensory
Probab=88.74  E-value=0.2  Score=43.35  Aligned_cols=29  Identities=14%  Similarity=0.069  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|+|.++.|||
T Consensus       126 ~~~~qi~~al~~LH~~~i~H~dlkp~nil  154 (280)
T cd05092         126 AIASQIASGMVYLASLHFVHRDLATRNCL  154 (280)
T ss_pred             HHHHHHHHHHHHHHHCCeecccccHhhEE
Confidence            34578999999999999999999999987


No 154
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 1 (CDKL1) and CDKL4 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL1 and CDKL4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL1, also called p42 KKIALRE, is a glial protein that is upregulated in gliosis. It is present in neuroblastoma and A431 human carcinoma cells, and may be implicated in neoplastic transformation. The functio
Probab=88.74  E-value=0.2  Score=42.73  Aligned_cols=32  Identities=3%  Similarity=-0.105  Sum_probs=27.9

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|+|.++.||+
T Consensus       101 ~~~~~~~ql~~~l~~LH~~~i~H~dl~p~nil  132 (286)
T cd07847         101 LIKKIIWQTLQAVNFCHKHNCIHRDVKPENIL  132 (286)
T ss_pred             HHHHHHHHHHHHHHHHHHCCceecCCChhhEE
Confidence            34455678999999999999999999999987


No 155
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1. Protein Tyrosine Kinase (PTK) family; Receptor tyrosine kinase-like Orphan Receptor 1 (Ror1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ror proteins are orphan receptor tyr kinases (RTKs) containing an extracellular region with immunoglobulin-like, cysteine-rich, and kringle domains, a transmembrane segment, and an intracellular catalytic domain. Ror RTKs are unrelated to the nuclear receptor subfamily called retinoid-related orphan receptors (RORs). RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase cataly
Probab=88.73  E-value=0.17  Score=43.58  Aligned_cols=29  Identities=17%  Similarity=0.139  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus       128 ~i~~~i~~al~~lH~~~i~H~dlkp~nil  156 (283)
T cd05090         128 HIAIQIAAGMEYLSSHFFVHKDLAARNIL  156 (283)
T ss_pred             HHHHHHHHHHHHHHhcCeehhccccceEE
Confidence            34578999999999999999999999986


No 156
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem ce
Probab=88.56  E-value=0.21  Score=46.27  Aligned_cols=29  Identities=21%  Similarity=0.107  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       218 ~~~~qi~~~l~~lH~~~ivH~Dlkp~Nil  246 (375)
T cd05104         218 SFSYQVAKGMSFLASKNCIHRDLAARNIL  246 (375)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCchhhEE
Confidence            44578999999999999999999999986


No 157
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK7 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK7, also called iodopsin kinase, belongs to the visual gr
Probab=88.55  E-value=0.2  Score=43.51  Aligned_cols=28  Identities=11%  Similarity=0.106  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|+|+++.|||
T Consensus       100 ~~~qi~~al~~lH~~~ivH~dikp~Nil  127 (277)
T cd05607         100 YSAQITCGILHLHSMDIVYRDMKPENVL  127 (277)
T ss_pred             HHHHHHHHHHHHHHCCEEEccCChHhEE
Confidence            3468999999999999999999999987


No 158
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor (VEGFR) subfamily; catalytic (c) domain. The VEGFR subfamily consists of VEGFR1 (Flt1), VEGFR2 (Flk1), VEGFR3 (Flt4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. In VEGFR3, the fifth Ig-like domain is replaced by a disulfide bridge. The binding of VEGFRs to their ligands, the VEGFs, leads to recepto
Probab=88.49  E-value=0.2  Score=45.59  Aligned_cols=29  Identities=21%  Similarity=0.118  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       177 ~~~~qi~~aL~~lH~~~ivHrDikp~Nil  205 (337)
T cd05054         177 SYSFQVARGMEFLASRKCIHRDLAARNIL  205 (337)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCcceEE
Confidence            34478999999999999999999999984


No 159
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4. Protein Tyrosine Kinase (PTK) family; HER4 (ErbB4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. HER4 is a member of the EGFR (HER, ErbB) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instead, they are activated by ligand-induced dimerization, leading to the phosphorylation of tyr residues in the C-terminal tail, which serve as bindin
Probab=88.27  E-value=0.21  Score=43.95  Aligned_cols=29  Identities=14%  Similarity=0.168  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       113 ~~~~qi~~~L~~LH~~~ivH~dikp~Nil  141 (303)
T cd05110         113 NWCVQIAKGMMYLEERRLVHRDLAARNVL  141 (303)
T ss_pred             HHHHHHHHHHHHHhhcCeeccccccceee
Confidence            34568999999999999999999999986


No 160
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) subfamily; catalytic (c) domain. The PDGFR subfamily consists of PDGFR alpha, PDGFR beta, KIT, CSF-1R, the mammalian FLT3, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR subfamily members are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. PDGFR kinase domains are autoinhibited by their juxtamembrane regions containing tyr residues. The binding to their ligands leads to recept
Probab=88.18  E-value=0.18  Score=44.65  Aligned_cols=30  Identities=17%  Similarity=0.109  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.+++|||
T Consensus       144 ~~i~~~i~~~l~~lH~~~ivH~dlkp~Nil  173 (302)
T cd05055         144 LSFSYQVAKGMAFLASKNCIHRDLAARNVL  173 (302)
T ss_pred             HHHHHHHHHHHHHHHHCCeehhhhccceEE
Confidence            345578999999999999999999999975


No 161
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase. Protein Tyrosine Kinase (PTK) family; Activated Cdc42-associated kinase (Ack) subfamily; catalytic (c) domain. Ack subfamily members include Ack1, thirty-eight-negative kinase 1 (Tnk1), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ack subfamily members are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal catalytic domain, an SH3 domain, a Cdc42-binding CRIB domain, and a proline-rich region. They are mainly expressed in brain and skeletal tissues and are involved in the regulation of cell adhesion and growth, receptor degradation, and axonal guidance. Ack1 is also associated with and
Probab=88.18  E-value=0.21  Score=42.06  Aligned_cols=28  Identities=21%  Similarity=0.247  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.+++||+
T Consensus       102 ~~~qi~~~L~~lH~~~i~H~di~p~nil  129 (257)
T cd05040         102 YAVQIANGMRYLESKRFIHRDLAARNIL  129 (257)
T ss_pred             HHHHHHHHHHHHHhCCccccccCcccEE
Confidence            3468999999999999999999999976


No 162
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa. Protein Tyrosine Kinase (PTK) family; Zeta-chain-associated protein of 70kDa (Zap-70); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Zap-70 is a member of the Syk subfamily of kinases, which are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. Zap-70 is primarily expressed in T-cells and NK cells, and is a crucial component in T-cell receptor (TCR) signaling. Zap-70 binds the phosphorylated ITAM (immunoreceptor tyr activation motif) sequences of the activated TCR zeta-chain through its SH2 domains, leading to its pho
Probab=88.16  E-value=0.2  Score=42.92  Aligned_cols=29  Identities=10%  Similarity=0.132  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.+++|||
T Consensus        99 ~~~~~i~~~l~~lH~~~i~H~dlkp~nil  127 (257)
T cd05115          99 ELMHQVSMGMKYLEGKNFVHRDLAARNVL  127 (257)
T ss_pred             HHHHHHHHHHHHHHhcCeeecccchheEE
Confidence            34568999999999999999999999986


No 163
>KOG0666 consensus Cyclin C-dependent kinase CDK8 [Transcription]
Probab=88.15  E-value=0.17  Score=49.75  Aligned_cols=27  Identities=15%  Similarity=0.084  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      --+|++++.|||+.=|+|||.|+||||
T Consensus       138 lwQil~Gv~YLH~NWvlHRDLKPaNIl  164 (438)
T KOG0666|consen  138 LWQILDGVHYLHSNWVLHRDLKPANIL  164 (438)
T ss_pred             HHHHHhhhHHHhhhheeeccCCcceEE
Confidence            358999999999999999999999997


No 164
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2. Protein Tyrosine Kinase (PTK) family; Tie2; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie2 is a receptor tyr kinase (RTK) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie2 is expressed mainly in endothelial cells and hematopoietic stem cells. It is also found in a subset of tumor-associated monocytes and eosinophils. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2. The binding of A
Probab=88.15  E-value=0.23  Score=43.93  Aligned_cols=31  Identities=13%  Similarity=0.104  Sum_probs=27.2

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .....+|+.+|++||+..|+|+|.+++|||=
T Consensus       127 ~~~~~qi~~al~~LH~~gi~H~dlkp~Nili  157 (303)
T cd05088         127 LHFAADVARGMDYLSQKQFIHRDLAARNILV  157 (303)
T ss_pred             HHHHHHHHHHHHHHHhCCccccccchheEEe
Confidence            3456789999999999999999999999874


No 165
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2. Protein Tyrosine Kinase (PTK) family; mammalian Discoidin Domain Receptor 2 (DDR2) and homologs; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR2 is a member of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDR2 binds mostly to fibrillar collagens. More recently, it has been reported to also bind collagen X. DDR2 is widely expressed in many tissues wit
Probab=88.12  E-value=0.21  Score=43.56  Aligned_cols=29  Identities=17%  Similarity=0.111  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       134 ~~~~~i~~al~~lH~~~i~H~dlkp~Nil  162 (296)
T cd05095         134 FMATQIASGMKYLSSLNFVHRDLATRNCL  162 (296)
T ss_pred             HHHHHHHHHHHHHHHCCeecccCChheEE
Confidence            34578999999999999999999999986


No 166
>KOG0659 consensus Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH/TFIIK, kinase subunit CDK7 [Cell cycle control, cell division, chromosome partitioning; Transcription; Replication, recombination and repair]
Probab=88.05  E-value=0.15  Score=48.94  Aligned_cols=40  Identities=5%  Similarity=-0.079  Sum_probs=35.0

Q ss_pred             CCccccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          213 SDCDRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       213 ~~~v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.+++.+++--+-...++.+|.|||.+-|.|||.|++|+|
T Consensus        94 ~~i~l~pa~iK~y~~m~LkGl~y~H~~~IlHRDlKPnNLL  133 (318)
T KOG0659|consen   94 KNIILSPADIKSYMLMTLKGLAYCHSKWILHRDLKPNNLL  133 (318)
T ss_pred             cccccCHHHHHHHHHHHHHHHHHHHhhhhhcccCCccceE
Confidence            4445677777888899999999999999999999999987


No 167
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 1 (MEKK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK1 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK1 activates the extracellular signal-regulated kinase 1/2 (ERK1/2) and c-Jun N-terminal kinase (JNK) pathways by activating their 
Probab=88.04  E-value=0.25  Score=41.75  Aligned_cols=29  Identities=10%  Similarity=0.140  Sum_probs=26.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|++||++.|+|+++++.+|+-
T Consensus       108 ~~~ql~~al~~LH~~~i~H~~i~~~nil~  136 (268)
T cd06630         108 YTEQLLRGLSYLHENQIIHRDVKGANLLI  136 (268)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEEE
Confidence            35899999999999999999999999873


No 168
>KOG0598 consensus Ribosomal protein S6 kinase and related proteins [General function prediction only; Signal transduction mechanisms]
Probab=88.04  E-value=0.24  Score=48.40  Aligned_cols=35  Identities=17%  Similarity=0.275  Sum_probs=30.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH------------hhhhcccc
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT------------GICRLSRD  260 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~------------~ic~l~~~  260 (264)
                      ..+|+-.|.+||++.|++||.|+-|||            |+||..-+
T Consensus       131 laEi~lAL~~LH~~gIiyRDlKPENILLd~~GHi~LtDFgL~k~~~~  177 (357)
T KOG0598|consen  131 LAEIVLALGYLHSKGIIYRDLKPENILLDEQGHIKLTDFGLCKEDLK  177 (357)
T ss_pred             HHHHHHHHHHHHhCCeeeccCCHHHeeecCCCcEEEeccccchhccc
Confidence            357999999999999999999999995            77775544


No 169
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=88.00  E-value=0.26  Score=41.89  Aligned_cols=29  Identities=17%  Similarity=0.079  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       110 ~~~~~i~~~l~~lH~~~i~H~dlkp~nil  138 (267)
T cd06645         110 YVSRETLQGLYYLHSKGKMHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34568999999999999999999999986


No 170
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein. Protein Tyrosine Kinase (PTK) family; RET (REarranged during Transfection) protein; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. RET is a receptor tyr kinase (RTK) containing an extracellular region with four cadherin-like repeats, a calcium-binding site, and a cysteine-rich domain, a transmembrane segment, and an intracellular catalytic domain. It is part of a multisubunit complex that binds glial-derived neurotropic factor (GDNF) family ligands (GFLs) including GDNF, neurturin, artemin, and persephin. GFLs bind RET along with four GPI-anchored coreceptors, bringing two RET molecules together, leadi
Probab=87.99  E-value=0.2  Score=43.54  Aligned_cols=30  Identities=17%  Similarity=0.141  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-..+|+.+|.+||+..|+|+|++++|||
T Consensus       130 ~~i~~~i~~~l~~LH~~~ivH~dikp~nil  159 (290)
T cd05045         130 ISFAWQISRGMQYLAEMKLVHRDLAARNVL  159 (290)
T ss_pred             HHHHHHHHHHHHHHHHCCeehhhhhhheEE
Confidence            345578999999999999999999999984


No 171
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), PCTAIRE-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily share sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. The association of PCTAIRE-like proteins with cyclins has not been widely studied, although PFTAIRE-1 has been shown to function as a CDK which is regulated by cyclin D3 as well as the 
Probab=87.87  E-value=0.25  Score=42.63  Aligned_cols=29  Identities=3%  Similarity=-0.040  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.+||
T Consensus       107 ~~~~ql~~al~~lH~~~i~H~dl~p~nil  135 (291)
T cd07844         107 LFLFQLLRGLAYCHQRRVLHRDLKPQNLL  135 (291)
T ss_pred             HHHHHHHHHHHHHHhCCeecccCCHHHEE
Confidence            34568999999999999999999999986


No 172
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), CMGC family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CMGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The CMGC family consists of Cyclin-Dependent protein Kinases (CDKs), Mitogen-activated protein kinases (MAPKs) such as Extracellular signal-regulated kinase (ERKs), c-Jun N-terminal kinases (JNKs), and p38, and similar proteins. CDKs belong to a large subfamily of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. MAPKs serve as important mediators of cellular responses to extracellular signals. They
Probab=87.86  E-value=0.25  Score=41.97  Aligned_cols=29  Identities=7%  Similarity=0.021  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|.++.+|+
T Consensus       102 ~~~~~i~~~l~~LH~~~i~H~dl~p~nil  130 (283)
T cd05118         102 SYLYQLLQGLAFCHSHGILHRDLKPENLL  130 (283)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCcCHHHEE
Confidence            34578999999999999999999999986


No 173
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2. Protein Tyrosine Kinase (PTK) family; Vascular Endothelial Growth Factor Receptor 2 (VEGFR2); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. VEGFR2 (or Flk1) is a member of the VEGFR subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with seven immunoglobulin (Ig)-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of VEGFRs to their ligands, the VEGFs, leads to receptor dimerization, activation, and intracellular signaling. The carboxyl terminus of VEGFR2 plays an important role in its autophosp
Probab=87.78  E-value=0.21  Score=45.22  Aligned_cols=29  Identities=17%  Similarity=0.098  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|+++.|||
T Consensus       183 ~~~~qi~~al~~lH~~~i~H~dikp~Nil  211 (343)
T cd05103         183 CYSFQVAKGMEFLASRKCIHRDLAARNIL  211 (343)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCccCeEE
Confidence            34568999999999999999999999986


No 174
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Extracellular signal-regulated kinases 1 and 2 (ERK1/2) and Fus3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. This ERK1/2-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the mitogen-activated protein kinases (MAPKs) ERK1, ERK2, baker's yeast Fus3, and similar proteins. MAPK pathways are important mediators of cellular responses to extracellular signals. ERK1/2 activation is preferentially by mitogenic factors, differentiation stimuli, and cytokines, through a kinase cascade involving the MAPK kinases MEK1/2 and a MAPK kinase
Probab=87.72  E-value=0.26  Score=44.21  Aligned_cols=28  Identities=7%  Similarity=0.097  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       111 i~~ql~~aL~~LH~~~ivH~dlkp~Nil  138 (336)
T cd07849         111 FLYQILRGLKYIHSANVLHRDLKPSNLL  138 (336)
T ss_pred             HHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3468999999999999999999999986


No 175
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases. Protein Tyrosine Kinase (PTK) family; Tropomyosin Related Kinase (Trk) subfamily; catalytic (c) domain. The Trk subfamily consists of TrkA, TrkB, TrkC, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Trk subfamily members are receptor tyr kinases (RTKs) containing an extracellular region with arrays of leucine-rich motifs flanked by two cysteine-rich clusters followed by two immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands, the nerve growth factor (NGF) family of neutrotrophins, leads to Trk receptor oligomerization and activation of the catalyt
Probab=87.67  E-value=0.24  Score=42.24  Aligned_cols=31  Identities=16%  Similarity=0.082  Sum_probs=27.4

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.||+
T Consensus       124 ~~~~~~~i~~~l~~lH~~~i~h~dlkp~nil  154 (280)
T cd05049         124 LLQIAVQIASGMVYLASQHFVHRDLATRNCL  154 (280)
T ss_pred             HHHHHHHHHHHHHHHhhCCeeccccccceEE
Confidence            3445688999999999999999999999986


No 176
>cd05043 PTK_Ryk Pseudokinase domain of Ryk (Receptor related to tyrosine kinase). Protein Tyrosine Kinase (PTK) family; Receptor related to tyrosine kinase (Ryk); pseudokinase domain. The PTKc (catalytic domain) family to which this subfamily belongs, is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Ryk is a receptor tyr kinase (RTK) containing an extracellular region with two leucine-rich motifs, a transmembrane segment, and an intracellular inactive pseudokinase domain. The extracellular region of Ryk shows homology to the N-terminal domain of Wnt inhibitory factor-1 (WIF) and serves as the ligand (Wnt) binding domain of Ryk. Ryk is expressed in many different tissues both during development and in adults, suggesting a widespread function. It 
Probab=87.63  E-value=0.23  Score=42.63  Aligned_cols=28  Identities=14%  Similarity=0.113  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++++||
T Consensus       122 i~~~i~~~l~~LH~~~i~H~di~p~nil  149 (280)
T cd05043         122 MAIQIACGMSYLHKRGVIHKDIAARNCV  149 (280)
T ss_pred             HHHHHHHHHHHHHHCCEeecccCHhhEE
Confidence            4458999999999999999999999985


No 177
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO1 is present in archaea, bacteria and eukaryotes. In addition, RIO3 is present in multicellular eukaryotes. RIO1 is essential for survival and is required for 18S rRNA processing, proper cell cycle pro
Probab=87.60  E-value=0.26  Score=41.63  Aligned_cols=30  Identities=10%  Similarity=0.094  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+..|.+||. +.|+|+|.+++||+
T Consensus       120 ~~i~~~l~~~l~~lH~~~givHrDlkP~NIl  150 (190)
T cd05145         120 EELYEQVVEQMRRLYQEAGLVHGDLSEYNIL  150 (190)
T ss_pred             HHHHHHHHHHHHHHHHhCCEecCCCChhhEE
Confidence            3445789999999999 99999999999987


No 178
>PRK10345 hypothetical protein; Provisional
Probab=87.53  E-value=0.26  Score=43.70  Aligned_cols=27  Identities=15%  Similarity=0.149  Sum_probs=24.2

Q ss_pred             hHHHHHHh-hhhccccccccCcchhhhH
Q 024658          226 STAIISSL-RGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl-~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+++..| ++||.+.|+|+|.|++|||
T Consensus       110 ~~~~L~~l~~yLh~~~IvhrDlKp~NIL  137 (210)
T PRK10345        110 LRQLLKKLKRYLLDNRIVTMELKPQNIL  137 (210)
T ss_pred             HHHHHHHHHHHHHHCCEeecCCCHHHEE
Confidence            46778777 8999999999999999997


No 179
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor. Protein Tyrosine Kinase (PTK) family; Insulin-like Growth Factor-1 Receptor (IGF-1R); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. IGF-1R is a receptor tyr kinases (RTK) that is composed of two alphabeta heterodimers. Binding of the ligand (IGF-1 or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, which stimulates downstream kinase activities and biological function. IGF-1R signaling is important in the differentiation, growth, and survival of normal cells. In cancer cells, wh
Probab=87.50  E-value=0.27  Score=42.29  Aligned_cols=27  Identities=15%  Similarity=0.117  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       125 ~~~l~~~l~~lH~~~~vH~dlkp~Nil  151 (277)
T cd05062         125 AGEIADGMAYLNANKFVHRDLAARNCM  151 (277)
T ss_pred             HHHHHHHHHHHHHCCcccCCcchheEE
Confidence            457999999999999999999999986


No 180
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MAST kinase subfamily includes MAST kinases, MAST-like (MASTL) kinases, and fungal kinases with similarity to Saccharomyces cerevisiae Rim15 and Schizosaccharomyces pombe cek1. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. MASTL kinases carry only a catalytic domain which contains a long insert re
Probab=87.48  E-value=0.28  Score=40.87  Aligned_cols=29  Identities=14%  Similarity=0.109  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|+++.||+
T Consensus        97 ~i~~qi~~~L~~lH~~~i~H~di~~~nil  125 (265)
T cd05579          97 IYIAEIVLALEYLHSNGIIHRDLKPDNIL  125 (265)
T ss_pred             HHHHHHHHHHHHHHHcCeecCCCCHHHeE
Confidence            44578999999999999999999999987


No 181
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron. Protein Tyrosine Kinase (PTK) family; Met and Ron; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Met and Ron are receptor tyr kinases (RTKs) composed of an alpha-beta heterodimer. The extracellular alpha chain is disulfide linked to the beta chain, which contains an extracellular ligand-binding region with a sema domain, a PSI domain and four IPT repeats, a transmembrane segment, and an intracellular catalytic domain. Binding to their ligands leads to receptor dimerization, autophosphorylation, activation, and intracellular signaling. Met binds to the ligand, hepatocyte growth factor/scatter factor (HGF/SF), and is also ca
Probab=87.47  E-value=0.26  Score=41.65  Aligned_cols=27  Identities=11%  Similarity=0.113  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       104 ~~~i~~~l~~lH~~~i~H~dlk~~nil  130 (262)
T cd05058         104 GLQVAKGMEYLASKKFVHRDLAARNCM  130 (262)
T ss_pred             HHHHHHHHHHHHhCCccccccCcceEE
Confidence            358999999999999999999999976


No 182
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK4-like group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. Members of the GRK4-like group include GRK4, GRK5, 
Probab=87.42  E-value=0.28  Score=42.86  Aligned_cols=29  Identities=14%  Similarity=0.141  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+++.||+
T Consensus       106 ~~~~qi~~~l~~lH~~~ivH~dlkp~Nil  134 (285)
T cd05605         106 FYAAEITCGLEDLHRERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHHCCcEecCCCHHHEE
Confidence            34578999999999999999999999987


No 183
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, GRK6 isoform, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. GRK6 is widely expressed in many tissues. t is expressed as 
Probab=87.42  E-value=0.27  Score=43.08  Aligned_cols=29  Identities=14%  Similarity=0.140  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       106 ~~~~qi~~~l~~lH~~~iiH~dikp~Nil  134 (285)
T cd05630         106 FYAAEICCGLEDLHQERIVYRDLKPENIL  134 (285)
T ss_pred             HHHHHHHHHHHHHHhCCEEeCCCCHHHEE
Confidence            34578999999999999999999999985


No 184
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 8 (CDK8)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK8-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK8, CDC2L6, and similar proteins. CDK8 functions as a negative or positive regulator of transcription, depending on the scenario. Together with its regulator, cyclin C, it reversibly associates with the 
Probab=87.41  E-value=0.28  Score=42.69  Aligned_cols=28  Identities=14%  Similarity=0.060  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       113 i~~qi~~~l~~lH~~~i~h~dlkp~Nil  140 (316)
T cd07842         113 LLWQILNGVHYLHSNWVLHRDLKPANIL  140 (316)
T ss_pred             HHHHHHHHHHHHHhCCEeeCCCCHHHEE
Confidence            3468999999999999999999999986


No 185
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases. Protein Tyrosine Kinase (PTK) family; Janus kinase (Jak) subfamily; catalytic (c) domain (repeat 2). The Jak subfamily is composed of Jak1, Jak2, Jak3, TYK2, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase catalytic domain. Most Jaks are expressed in a wide variety of tissues, except for Jak3, which is expressed only in hematopoietic cells. Jaks are crucial for cytokine receptor signaling. They are activated by aut
Probab=87.40  E-value=0.29  Score=41.59  Aligned_cols=30  Identities=23%  Similarity=0.137  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       112 ~~~~~~l~~aL~~lH~~~i~H~dl~p~nil  141 (284)
T cd05038         112 LLFSSQICKGMDYLGSQRYIHRDLAARNIL  141 (284)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHhEE
Confidence            345578999999999999999999999986


No 186
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase. Protein Tyrosine Kinase (PTK) family; Anaplastic Lymphoma Kinase (ALK) and Leukocyte Tyrosine (tyr) Kinase (LTK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyr residues in protein substrates. ALK and LTK are orphan receptor tyr kinases (RTKs) whose ligands are not yet well-defined. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. They are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. ALK appears to play an important role in mammalian neural development as well
Probab=87.39  E-value=0.23  Score=42.87  Aligned_cols=29  Identities=10%  Similarity=0.022  Sum_probs=26.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||=
T Consensus       121 ~~~qi~~~l~~LH~~~ivH~dlkp~nil~  149 (277)
T cd05036         121 CARDVAKGCKYLEENHFIHRDIAARNCLL  149 (277)
T ss_pred             HHHHHHHHHHHHHHCCEeecccchheEEE
Confidence            45689999999999999999999999873


No 187
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). The InsR subfamily is composed of InsR, Insulin-like Growth Factor-1 Receptor (IGF-1R), and similar proteins. PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR and IGF-1R are receptor tyr kinases (RTKs) composed of two alphabeta heterodimers. Binding of the ligand (insulin, IGF-1, or IGF-2) to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological 
Probab=87.39  E-value=0.25  Score=42.08  Aligned_cols=28  Identities=14%  Similarity=0.112  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|+++.+||
T Consensus       124 ~~~~i~~~l~~lH~~~i~H~di~p~nil  151 (277)
T cd05032         124 MAAEIADGMAYLAAKKFVHRDLAARNCM  151 (277)
T ss_pred             HHHHHHHHHHHHHhCCccccccChheEE
Confidence            3468999999999999999999999975


No 188
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST-like (MASTL) kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. The MASTL kinases in this group carry only a catalytic domain, which contains a long insertion relative to MAST kinases. The human MASTL gene has also been labelled FLJ14813. A missense mutation in FLJ1481
Probab=87.38  E-value=0.26  Score=50.14  Aligned_cols=29  Identities=7%  Similarity=0.060  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|+|+.|||
T Consensus       108 ~i~~qil~aL~yLH~~gIiHrDLKP~NIL  136 (669)
T cd05610         108 KYISEVALALDYLHRHGIIHRDLKPDNML  136 (669)
T ss_pred             HHHHHHHHHHHHHHhCCEEeCCccHHHEE
Confidence            34578999999999999999999999996


No 189
>KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=87.34  E-value=0.31  Score=46.45  Aligned_cols=26  Identities=12%  Similarity=0.081  Sum_probs=22.7

Q ss_pred             HHHHHHhhhhcccc---ccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQT---MTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~---i~~~d~~~a~i~  252 (264)
                      ..|-.+|.|||+..   |||||+|++|||
T Consensus       181 ~g~A~gL~yLH~~~~~~iiHrDiKssNIL  209 (361)
T KOG1187|consen  181 LGAARGLAYLHEGCPPPIIHRDIKSSNIL  209 (361)
T ss_pred             HHHHHHHHHHccCCCCCEecCCCCHHHee
Confidence            45667999999966   999999999997


No 190
>KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=87.32  E-value=0.25  Score=49.64  Aligned_cols=26  Identities=19%  Similarity=0.217  Sum_probs=24.9

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.++.+|++||++..||||+|+||||
T Consensus       118 re~l~~l~ylH~~~kiHrDIKaanil  143 (467)
T KOG0201|consen  118 REVLKGLDYLHSEKKIHRDIKAANIL  143 (467)
T ss_pred             HHHHHHhhhhhhcceeccccccccee
Confidence            78899999999999999999999997


No 191
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades t
Probab=87.29  E-value=0.31  Score=41.11  Aligned_cols=29  Identities=14%  Similarity=0.195  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||...|+|+|.++.||+
T Consensus       108 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  136 (263)
T cd06625         108 KYTRQILEGVEYLHSNMIVHRDIKGANIL  136 (263)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999987


No 192
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, fungal Rim15-like kinases, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include Saccharomyces cerevisiae Rim15, Schizosaccharomyces pombe cek1, and similar fungal proteins. They contain a central catalytic domain, which contains an insert relative to MAST kinases. In addition, Rim15 contains a C-terminal signal receiver (REC) domain while cek1 contains an N-terminal PAS domain. Rim15 (or Rim15p) functions as a regulator of meiosis. It acts as a do
Probab=87.24  E-value=0.31  Score=41.22  Aligned_cols=28  Identities=4%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|++.++.+|+
T Consensus       102 i~~qi~~aL~~lH~~~i~H~dl~p~nil  129 (260)
T cd05611         102 YIAEVVLGVEDLHQRGIIHRDIKPENLL  129 (260)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            3478999999999999999999999986


No 193
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 7 (CDK7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK7 plays essential roles in the cell cycle and in transcription. It associates with cyclin H and MAT1 and acts as a CDK-Activating Kinase (CAK) by phosphorylating and activating cell cycle CDKs (CDK1/2/4/6). In the brain, it activates CDK5. CDK7 is 
Probab=87.24  E-value=0.3  Score=42.38  Aligned_cols=29  Identities=10%  Similarity=0.038  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       106 ~~~~qi~~al~~lH~~~i~H~dl~p~nil  134 (298)
T cd07841         106 SYMLMTLRGLEYLHSNWILHRDLKPNNLL  134 (298)
T ss_pred             HHHHHHHHHHHHHHhCCeeecCCChhhEE
Confidence            34578999999999999999999999985


No 194
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; C-terminal Src kinase (Csk) subfamily; catalytic (c) domain. The Csk subfamily is composed of Csk, Chk, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. To inhibit Src kinases, Csk and Chk are translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Csk 
Probab=87.24  E-value=0.23  Score=41.91  Aligned_cols=29  Identities=10%  Similarity=0.145  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~qi~~~l~~lh~~~i~H~di~p~Nil  134 (256)
T cd05039         106 GFALDVCEGMEYLEEKNFVHRDLAARNVL  134 (256)
T ss_pred             HHHHHHHHHHHHHHhCCccchhcccceEE
Confidence            34468999999999999999999999986


No 195
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 4 (Nek4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek4 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. Nek4 is highly abundant in the testis. Its specific function is unknown.
Probab=87.23  E-value=0.28  Score=41.17  Aligned_cols=30  Identities=13%  Similarity=0.119  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-..+|+.+|.+||++.|+|+|++++||+
T Consensus       105 ~~~~~~l~~~l~~lH~~~i~H~di~p~nil  134 (257)
T cd08223         105 VEWFVQIAMALQYLHEKHILHRDLKTQNVF  134 (257)
T ss_pred             HHHHHHHHHHHHHHHhCCeeccCCCchhEE
Confidence            344578999999999999999999999985


No 196
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, beta-adrenergic receptor kinase (beta-ARK) group, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. There are seven types of GRKs, named GRK1 to GRK7. The beta-ARK group is co
Probab=87.10  E-value=0.3  Score=42.51  Aligned_cols=29  Identities=21%  Similarity=0.170  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|++++||+
T Consensus       101 ~~~~ql~~~l~~lH~~~i~H~di~p~nil  129 (278)
T cd05606         101 FYAAEIILGLEHMHNRFVVYRDLKPANIL  129 (278)
T ss_pred             HHHHHHHHHHHHHHHCCEEcCCCCHHHEE
Confidence            44578999999999999999999999986


No 197
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) subfamily; catalytic (c) domain. The Tec subfamily is composed of Tec, Btk, Bmx (Etk), Itk (Tsk, Emt), Rlk (Txk), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec kinases are cytoplasmic (or nonreceptor) tyr kinases (nRTKs) with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows
Probab=87.08  E-value=0.29  Score=41.61  Aligned_cols=29  Identities=10%  Similarity=0.109  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       104 ~i~~qi~~~l~~lH~~~i~H~dl~p~ni~  132 (256)
T cd05059         104 DMCSDVCEAMEYLESNGFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHHCCcccccccHhhEE
Confidence            34578999999999999999999999986


No 198
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 8 (Nek8) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek8 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek8 contains an N-terminal kinase catalytic domain and a C-terminal RCC1 (regulator of chromosome condensation) domain. A double point mutation in Nek8 causes cystic kidney disease in mice that genetically resembles human autosomal recessive polycystic kidney disease (ARPKD). Nek8 is also associated with 
Probab=87.01  E-value=0.32  Score=40.73  Aligned_cols=27  Identities=11%  Similarity=0.142  Sum_probs=25.2

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|++||++.|+|++.++.+|+
T Consensus       107 ~~~i~~~l~~lh~~~i~h~dl~~~nil  133 (256)
T cd08220         107 FVQILLALHHVHTKLILHRDLKTQNIL  133 (256)
T ss_pred             HHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            468999999999999999999999988


No 199
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase. Serine/threonine kinases (STKs), Traf2- and Nck-interacting kinase (TNIK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TNIK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to mitogen-activated protein kinase (MAPK), kinase kinase kinase 4 (MAP4K4), and MAP4K6. MAP4Ks participate in some MAPK signaling pathways by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). TNIK is an effector of Rap2, a small GTP-binding protein from the Ras family. TNIK specifically activ
Probab=86.95  E-value=0.32  Score=41.33  Aligned_cols=28  Identities=11%  Similarity=0.177  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       116 ~~~qi~~~l~~LH~~~ivh~dl~~~nil  143 (272)
T cd06637         116 ICREILRGLSHLHQHKVIHRDIKGQNVL  143 (272)
T ss_pred             HHHHHHHHHHHHHHCCCccCCCCHHHEE
Confidence            4468999999999999999999999985


No 200
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase. Serine/Threonine Kinases (STKs), PCTAIRE-1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PCTAIRE-1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PCTAIRE-1 shares sequence similarity with Cyclin-Dependent Kinases (CDKs), which belong to a large family of STKs that are regulated by their cognate cyclins. Together, CDKs and cyclins are involved in the control of cell-cycle progression, transcription, and neuronal function. PCTAIRE-1 is expressed ubiquitously and is localized in the cytoplasm. Its kinase activity is cell cycle dependent and peaks at the S and G2 phases. PCTAIRE-1 is highly expressed in the brain and may pl
Probab=86.90  E-value=0.34  Score=42.43  Aligned_cols=28  Identities=4%  Similarity=-0.007  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       109 ~~~qi~~aL~~lH~~~i~H~dlkp~Nil  136 (301)
T cd07873         109 FLFQLLRGLNYCHRRKVLHRDLKPQNLL  136 (301)
T ss_pred             HHHHHHHHHHHHHhCCeeCCCCCHHHEE
Confidence            4578999999999999999999999986


No 201
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 5 (MAPKKKK5 or MAP4K5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Each MAPK cascade is activated 
Probab=86.90  E-value=0.34  Score=41.22  Aligned_cols=29  Identities=14%  Similarity=0.069  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       110 ~~~~qi~~~l~~lH~~~i~H~dl~p~nil  138 (267)
T cd06646         110 YVCRETLQGLAYLHSKGKMHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            45578999999999999999999999985


No 202
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros. Protein Tyrosine Kinases (PTK) family; C-ros and Drosophila Sevenless proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The proto-oncogene c-ros encodes an orphan receptor tyr kinase (RTK) with an unknown ligand. RTKs contain an extracellular ligand-binding domain, a transmembrane region, and an intracellular tyr kinase domain. RTKs are usually activated through ligand binding, which causes dimerization and autophosphorylation of the intracellular tyr kinase catalytic domain. C-ros is expressed in embryonic cells of the kidney, intestine and lung, but disappears soon after birth. It persists only in the adult epididymis. Male
Probab=86.89  E-value=0.28  Score=41.59  Aligned_cols=29  Identities=10%  Similarity=-0.026  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|++||++.|+|+|.++.+|+
T Consensus       110 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  138 (269)
T cd05044         110 DICLDVAKGCVYLEQMHFIHRDLAARNCL  138 (269)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCChheEE
Confidence            34468899999999999999999999987


No 203
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 3 (FGFR3); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR3 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=86.85  E-value=0.28  Score=43.96  Aligned_cols=28  Identities=14%  Similarity=0.087  Sum_probs=25.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhHh
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||=
T Consensus       140 ~~qi~~al~~LH~~givH~dlkp~Nill  167 (334)
T cd05100         140 AYQVARGMEYLASQKCIHRDLAARNVLV  167 (334)
T ss_pred             HHHHHHHHHHHHHCCeeccccccceEEE
Confidence            4689999999999999999999999863


No 204
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk. Protein Tyrosine Kinase (PTK) family; Lck and Blk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lck (lymphocyte-specific kinase) and Blk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Sr
Probab=86.79  E-value=0.33  Score=41.20  Aligned_cols=29  Identities=14%  Similarity=0.137  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-..+|+.+|++||+..|+|+|.+++||+
T Consensus       106 ~i~~~i~~al~~LH~~~i~H~dl~p~ni~  134 (260)
T cd05067         106 DMAAQIAEGMAFIERKNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHhcCCeecccccHHhEE
Confidence            34568999999999999999999999975


No 205
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Fes subfamily; catalytic (c) domain. Fes subfamily members include Fes (or Fps), Fer, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fes subfamily proteins are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. The genes for Fes (feline sarcoma) and Fps (Fujinami poultry sarcoma) were first isolated from tumor-causing retroviruses. The viral oncogenes encode chimeric Fes proteins consisting of Gag sequences at the N-termini, resulting in unregulated tyr k
Probab=86.74  E-value=0.28  Score=41.22  Aligned_cols=28  Identities=14%  Similarity=0.057  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus        98 ~~~~~~~~l~~lH~~~i~h~di~p~nil  125 (251)
T cd05041          98 MSLDAAAGMEYLESKNCIHRDLAARNCL  125 (251)
T ss_pred             HHHHHHHHHHHHHhCCEehhhcCcceEE
Confidence            3467889999999999999999999986


No 206
>PRK09188 serine/threonine protein kinase; Provisional
Probab=86.73  E-value=0.28  Score=47.31  Aligned_cols=29  Identities=14%  Similarity=0.083  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCc-chhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGD-AAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~-~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|||. |++|||
T Consensus       115 ~~~~~i~~aL~~lH~~gIiHrDL~KP~NIL  144 (365)
T PRK09188        115 AWFRSAHRALRDLHRAGITHNDLAKPQNWL  144 (365)
T ss_pred             HHHHHHHHHHHHHHHCCCeeCCCCCcceEE
Confidence            34578999999999999999999 999987


No 207
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor. Protein Tyrosine Kinase (PTK) family; Insulin Receptor (InsR); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. InsR is a receptor tyr kinase (RTK) that is composed of two alphabeta heterodimers. Binding of the insulin ligand to the extracellular alpha subunit activates the intracellular tyr kinase domain of the transmembrane beta subunit. Receptor activation leads to autophosphorylation, stimulating downstream kinase activities, which initiate signaling cascades and biological function. InsR signaling plays an important role in many cellular processes including glucose homeostasis, glycogen synthesis, lipid and protein meta
Probab=86.68  E-value=0.3  Score=42.47  Aligned_cols=27  Identities=15%  Similarity=0.148  Sum_probs=24.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||.+.|+|+|.++.|||
T Consensus       125 ~~~l~~~l~~lH~~~i~H~dikp~nil  151 (288)
T cd05061         125 AAEIADGMAYLNAKKFVHRDLAARNCM  151 (288)
T ss_pred             HHHHHHHHHHHHhCCCcCCCCChheEE
Confidence            357889999999999999999999985


No 208
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 6, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK6 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK6 may play a role i
Probab=86.65  E-value=0.34  Score=42.76  Aligned_cols=30  Identities=13%  Similarity=0.189  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+...+|+.+|.+||++.|+|+|.++.||+
T Consensus       120 ~~~~~qi~~~L~~LH~~~ivH~dl~p~Nil  149 (297)
T cd06659         120 ATVCESVLQALCYLHSQGVIHRDIKSDSIL  149 (297)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHHeE
Confidence            345678999999999999999999999985


No 209
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii FA2-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii FA2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes FA2 and CNK4.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii FA2 was discovered in a genetic screen for deflagellation-defective mutants. It is essential for basal-body/centriole-associated microtubule severing, and plays a role in cell cyc
Probab=86.63  E-value=0.31  Score=40.80  Aligned_cols=28  Identities=11%  Similarity=0.088  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       106 i~~~l~~al~~lH~~~i~h~dl~~~nil  133 (256)
T cd08529         106 FFIQILLGLAHLHSKKILHRDIKSLNLF  133 (256)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCcceEE
Confidence            3468999999999999999999999986


No 210
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome. Protein Tyrosine Kinase (PTK) family; Bruton's tyrosine kinase (Btk) and Bone marrow kinase on the X chromosome (Bmx); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Btk and Bmx (also named Etk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds 
Probab=86.53  E-value=0.3  Score=41.73  Aligned_cols=29  Identities=10%  Similarity=0.092  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.|||
T Consensus       104 ~~~~~i~~~l~~lH~~~i~H~dl~p~nil  132 (256)
T cd05113         104 EMCKDVCEGMAYLESKQFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHhCCeeccccCcceEE
Confidence            45578999999999999999999999987


No 211
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3)-like subfamily, catalytic (c) domain, functionally uncharacterized subgroup 1. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The MEKK3-like subfamily is composed of MEKK3, MEKK2, and related proteins, all containing an N-terminal PB1 domain, which mediates oligomerization, and a C-terminal catalytic domain. MEKK2 and MEKK3 are mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks), proteins that phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phospho
Probab=86.51  E-value=0.36  Score=41.23  Aligned_cols=28  Identities=14%  Similarity=0.194  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|++.+++||+
T Consensus       111 ~~~~i~~al~~LH~~~i~H~dl~p~ni~  138 (264)
T cd06653         111 YTRQILQGVSYLHSNMIVHRDIKGANIL  138 (264)
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            4478999999999999999999999987


No 212
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk. Protein Tyrosine Kinase (PTK) family; Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristylation sites (Srm) and breast tumor kinase (Brk, also called protein tyrosine kinase 6); catalytic (c) domains. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Srm and Brk are a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases in general contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr; they are activated by autophosphorylation at the tyr kinase dom
Probab=86.43  E-value=0.29  Score=41.33  Aligned_cols=28  Identities=18%  Similarity=0.147  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.||+
T Consensus       109 ~~~~i~~al~~lH~~~i~h~dl~~~nil  136 (261)
T cd05148         109 MACQVAEGMAYLEEQNSIHRDLAARNIL  136 (261)
T ss_pred             HHHHHHHHHHHHHHCCeeccccCcceEE
Confidence            4468899999999999999999999875


No 213
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase. Protein Tyrosine Kinase (PTK) family; Focal Adhesion Kinase (FAK); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FAK is a cytoplasmic (or nonreceptor) tyr kinase that contains an autophosphorylation site and a FERM domain at the N-terminus, a central tyr kinase domain, proline-rich regions, and a C-terminal FAT (focal adhesion targeting) domain. FAK activity is dependent on integrin-mediated cell adhesion, which facilitates N-terminal autophosphorylation. Full activation is achieved by the phosphorylation of its two adjacent A-loop tyrosines. FAK is important in mediating signaling initiated at sites of cell adhesions
Probab=86.42  E-value=0.3  Score=41.71  Aligned_cols=29  Identities=17%  Similarity=0.147  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.+++|||
T Consensus       111 ~~~~~l~~~l~~lH~~~~~H~dl~p~nil  139 (270)
T cd05056         111 LYSYQLSTALAYLESKRFVHRDIAARNVL  139 (270)
T ss_pred             HHHHHHHHHHHHHHhCCeeccccChheEE
Confidence            34568999999999999999999999985


No 214
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 4 (MAPKKKK4 or MAP4K4) and MAPKKKK6 (or MAP4K6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K4/MAP4K6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain. MAP4Ks (or MAPKKKKs) are involved in MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activating a MAPK kinase kinase (MAPKKK or MAP3K or MKKK). Ea
Probab=86.40  E-value=0.36  Score=41.52  Aligned_cols=27  Identities=11%  Similarity=0.196  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|++.++.||+
T Consensus       127 ~~qi~~al~~LH~~~ivH~dl~~~nil  153 (282)
T cd06636         127 CREILRGLAHLHAHKVIHRDIKGQNVL  153 (282)
T ss_pred             HHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            457999999999999999999999976


No 215
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Class III myosin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins with an N-terminal kinase catalytic domain and a C-terminal actin-binding motor domain. Class III myosins are present in the photoreceptors of invertebrates and vertebrates and in the auditory hair cells of mammals. The kinase domain of myosin III can phosphorylate several cytoskeletal proteins, conventional myosin regulatory light chains, and can autophosphorylate the C-terminal motor domain. Myosin I
Probab=86.37  E-value=0.41  Score=40.27  Aligned_cols=29  Identities=10%  Similarity=0.044  Sum_probs=26.2

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|++||++.|+|++.++++|+
T Consensus       117 ~~~~ql~~al~~lH~~~i~H~~l~p~ni~  145 (275)
T cd06608         117 YILRETLRGLAYLHENKVIHRDIKGQNIL  145 (275)
T ss_pred             HHHHHHHHHHHHHhcCCcccCCCCHHHEE
Confidence            34578999999999999999999999987


No 216
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK9 and CDK12 from higher eukaryotes, yeast BUR1, C-type plant CDKs (CdkC), and similar proteins. CDK9, BUR1, and CdkC are functionally equivalent. They act as a kinase for the C-terminal domain of RNA po
Probab=86.34  E-value=0.37  Score=40.94  Aligned_cols=32  Identities=13%  Similarity=0.131  Sum_probs=27.9

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|++||++.|+|++.++.||+
T Consensus       101 ~~~~i~~~i~~al~~LH~~~~~h~dl~p~nil  132 (287)
T cd07840         101 QIKCYMKQLLEGLQYLHSNGILHRDIKGSNIL  132 (287)
T ss_pred             HHHHHHHHHHHHHHHHHHCCceeccCcHHHeE
Confidence            34456688999999999999999999999986


No 217
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase. Serine/Threonine Kinases (STKs), c-Jun N-terminal kinase (JNK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The JNK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. JNKs are mitogen-activated protein kinases (MAPKs) that are involved in many stress-activated responses including those during inflammation, neurodegeneration, apoptosis, and persistent pain sensitization, among others. They are also essential regulators of physiological and pathological processes and are involved in the pathogenesis of several diseases such as diabetes, atherosclerosis, stroke, Parkinson's and Alzheimer's. Vetebrates harbor three different JNK
Probab=86.33  E-value=0.34  Score=43.84  Aligned_cols=28  Identities=7%  Similarity=0.156  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.|||
T Consensus       123 ~~~ql~~aL~~LH~~gi~H~dlkp~Nil  150 (353)
T cd07850         123 LLYQMLCGIKHLHSAGIIHRDLKPSNIV  150 (353)
T ss_pred             HHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            3578999999999999999999999986


No 218
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 7 (Nek7) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek7 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek7 is required for mitotic spindle formation and cytokinesis. It is enriched in the centrosome and is critical for microtubule nucleation. Nek7 is activated by Nek9 during mitosis, and may regulate the p70 ribosomal S6 kinase.
Probab=86.31  E-value=0.37  Score=40.82  Aligned_cols=28  Identities=11%  Similarity=0.139  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       111 ~~~~i~~~l~~LH~~~i~H~dl~p~nil  138 (267)
T cd08229         111 YFVQLCSALEHMHSRRVMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            3568999999999999999999999985


No 219
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Tie subfamily; catalytic (c) domain. The Tie subfamily consists of Tie1 and Tie2. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tie proteins are receptor tyr kinases (RTKs) containing an extracellular region, a transmembrane segment, and an intracellular catalytic domain. The extracellular region contains an immunoglobulin (Ig)-like domain, three epidermal growth factor (EGF)-like domains, a second Ig-like domain, and three fibronectin type III repeats. Tie receptors are specifically expressed in endothelial cells and hematopoietic stem cells. The angiopoietins (Ang-1 to Ang-4) serve as ligands for Tie2, while no specific l
Probab=86.27  E-value=0.3  Score=41.99  Aligned_cols=29  Identities=14%  Similarity=0.129  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|+++.|||
T Consensus       116 ~~~~~i~~al~~lH~~~i~H~dikp~nil  144 (270)
T cd05047         116 HFAADVARGMDYLSQKQFIHRDLAARNIL  144 (270)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccccceEE
Confidence            34467889999999999999999999987


No 220
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase. Protein Tyrosine Kinase (PTK) family; Muscle-specific kinase (Musk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Musk is a receptor tyr kinase (RTK) containing an extracellular region with four immunoglobulin-like domains and a cysteine-rich cluster, a transmembrane segment, and an intracellular catalytic domain. Musk is expressed and concentrated in the postsynaptic membrane in skeletal muscle. It is essential for the establishment of the neuromuscular junction (NMJ), a peripheral synapse that conveys signals from motor neurons to muscle cells. Agrin, a large proteoglycan released from motor neurons, stimulates M
Probab=86.24  E-value=0.34  Score=41.89  Aligned_cols=29  Identities=7%  Similarity=0.079  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.+++|||
T Consensus       134 ~~~~~i~~aL~~lH~~~i~H~dl~p~nil  162 (288)
T cd05050         134 CIAKQVAAGMAYLSERKFVHRDLATRNCL  162 (288)
T ss_pred             HHHHHHHHHHHHHHhCCeecccccHhheE
Confidence            45678999999999999999999999986


No 221
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase,  Extracellular signal-Regulated Kinase 5. Serine/Threonine Kinases (STKs), Extracellular signal-Regulated Kinase 5 (ERK5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The ERK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. ERK5, also called Big MAPK1 (BMK1) or MAPK7, has a unique C-terminal extension, making it approximately twice as big as other MAPKs. This extension contains transcriptional activation capability which is inhibited by the N-terminal half. ERK5 is activated in response to growth factors and stress by a cascade that leads to its phosphorylation by the 
Probab=86.22  E-value=0.36  Score=43.27  Aligned_cols=29  Identities=3%  Similarity=0.067  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|++.++.|||
T Consensus       111 ~i~~qi~~aL~~LH~~~ivH~dlkp~Nil  139 (334)
T cd07855         111 YFLYQLLRGLKYIHSANVIHRDLKPSNLL  139 (334)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34578999999999999999999999986


No 222
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Spleen Tyrosine Kinase (Syk) subfamily; catalytic (c) domain. The Syk subfamily is composed of Syk, ZAP-70, Shark, and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Syk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing two Src homology 2 (SH2) domains N-terminal to the catalytic tyr kinase domain. They are involved in the signaling downstream of activated receptors (including B-cell, T-cell, and Fc receptors) that contain ITAMs (immunoreceptor tyr activation motifs), leading to processes such as cell proliferation, differentiation, survival, adhesion, mi
Probab=86.18  E-value=0.32  Score=41.24  Aligned_cols=30  Identities=10%  Similarity=0.078  Sum_probs=26.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .-..+|+.+|.+||+..|+|+|.++.|||-
T Consensus        99 ~~~~qi~~~l~~lh~~~i~H~di~p~nili  128 (257)
T cd05060          99 ELAHQVAMGMAYLESKHFVHRDLAARNVLL  128 (257)
T ss_pred             HHHHHHHHHHHHHhhcCeeccCcccceEEE
Confidence            445789999999999999999999999873


No 223
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5. Protein kinases (PKs), MAP kinase kinase 5 (MKK5) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK5 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK5, also referred to as MEK5, is a dual-specificity PK that p
Probab=86.17  E-value=0.36  Score=41.79  Aligned_cols=28  Identities=11%  Similarity=0.127  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       100 ~~~qi~~~l~~lH~~~i~H~dlkp~Nil  127 (279)
T cd06619         100 IAVAVVKGLTYLWSLKILHRDVKPSNML  127 (279)
T ss_pred             HHHHHHHHHHHHHHCCEeeCCCCHHHEE
Confidence            4578999999999999999999999986


No 224
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 9 (CDK9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK9 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK9 together with a cyclin partner (cyclin T1, T2a, T2b, or K) is the main component of distinct positive transcription elongation factors (P-TEFb), which function as Ser2 C-terminal domain kinases of RNA polymerase II. P-TEFb participates in multipl
Probab=86.11  E-value=0.36  Score=41.72  Aligned_cols=29  Identities=14%  Similarity=0.155  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||+..|+|+|.++.||+
T Consensus       123 ~i~~qi~~al~~lH~~~i~H~dl~p~nil  151 (310)
T cd07865         123 KVMKMLLNGLYYIHRNKILHRDMKAANIL  151 (310)
T ss_pred             HHHHHHHHHHHHHHHCCeeccCCCHHHEE
Confidence            34578999999999999999999999984


No 225
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Discoidin Domain Receptor (DDR)-like proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. DDR-like proteins are members of the DDR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular discoidin homology domain, a transmembrane segment, an extended juxtamembrane region, and an intracellular catalytic domain. The binding of the ligand, collagen, to DDRs results in a slow but sustained receptor activation. DDRs regulate cell adhesion, proliferation, and extracellular matrix remodeling. They have been linked to a variety of human cancers including 
Probab=86.09  E-value=0.36  Score=42.10  Aligned_cols=28  Identities=14%  Similarity=0.114  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++||+
T Consensus       134 i~~~i~~al~~lH~~~i~H~dlkp~Nil  161 (295)
T cd05097         134 MAVQIASGMKYLASLNFVHRDLATRNCL  161 (295)
T ss_pred             HHHHHHHHHHHHHhcCeeccccChhhEE
Confidence            4578999999999999999999999987


No 226
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10. Serine/Threonine Kinases (STKs), Cyclin-dependent protein Kinase 10 (CDK10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK10, also called PISSLRE, is essential for cell growth and proliferation, and acts through the G2/M phase of the cell cycle. CDK10 has also been identified as an important factor in endocrine therapy resistance in breast cancer. CDK10 silencing
Probab=85.99  E-value=0.37  Score=42.32  Aligned_cols=30  Identities=7%  Similarity=0.081  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|+|.++.|||
T Consensus       111 ~~~~~qi~~~l~~lH~~~i~H~dl~p~nil  140 (309)
T cd07845         111 KCLMLQLLRGLQYLHENFIIHRDLKVSNLL  140 (309)
T ss_pred             HHHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            445688999999999999999999999986


No 227
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 2 (MEKK2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK2 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK2 also activates ERK1/2, c-Jun N-terminal kinase (JNK) and p38 through their re
Probab=85.91  E-value=0.4  Score=40.83  Aligned_cols=29  Identities=14%  Similarity=0.188  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.||+
T Consensus       110 ~~~~~l~~~l~~lH~~~i~H~dl~p~nil  138 (265)
T cd06652         110 KYTRQILEGVSYLHSNMIVHRDIKGANIL  138 (265)
T ss_pred             HHHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            44578999999999999999999999997


No 228
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk. Protein Tyrosine Kinase (PTK) family; Fyn and Yrk kinases; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fyn and Yrk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that r
Probab=85.87  E-value=0.35  Score=41.06  Aligned_cols=28  Identities=7%  Similarity=0.105  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~~l~~al~~lH~~~i~H~di~p~Nil  134 (260)
T cd05070         107 MAAQVAAGMAYIERMNYIHRDLRSANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCccceEE
Confidence            3478999999999999999999999974


No 229
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cAMP-dependent protein kinase (PKA) subfamily, catalytic (c) subunit. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PKA subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This subfamily is composed of the cAMP-dependent proteins kinases, PKA and PRKX. The inactive PKA holoenzyme is a heterotetramer composed of two phosphorylated and active catalytic (C) subunits with a dimer of regulatory (R) subunits. Activation is achieved through the binding of the important second messenger cAMP to the R subunits, which leads to the dissociation of PKA into the R dimer and two active C subunits. PKA is present ubi
Probab=85.80  E-value=0.39  Score=41.81  Aligned_cols=28  Identities=7%  Similarity=0.100  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|+|+|.++++||
T Consensus       106 ~~~qil~~l~~lH~~~i~H~dl~p~nil  133 (290)
T cd05580         106 YAAQVVLALEYLHSLDIVYRDLKPENLL  133 (290)
T ss_pred             HHHHHHHHHHHHHHCCEecCCCCHHHEE
Confidence            3468999999999999999999999986


No 230
>cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins. Serine/Threonine Kinases (STKs), Bypass UAS Requirement 1 (BUR1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The BUR1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. BUR1, also called SGV1, is a yeast Cyclin-Dependent protein Kinase (CDK) that is functionally equivalent to mammalian CDK9. It associates with the cyclin BUR2. BUR genes were orginally identified in a genetic 
Probab=85.80  E-value=0.39  Score=41.51  Aligned_cols=29  Identities=14%  Similarity=0.156  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       119 ~i~~~l~~al~~lH~~~i~H~dl~p~nil  147 (311)
T cd07866         119 CYMLQLLEGINYLHENHILHRDIKAANIL  147 (311)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999985


No 231
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes. Protein Tyrosine Kinase (PTK) family; Yes kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Yes (or c-Yes) is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine an
Probab=85.76  E-value=0.35  Score=41.18  Aligned_cols=28  Identities=14%  Similarity=0.124  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~~l~~al~~lH~~~i~H~dl~~~Nil  134 (260)
T cd05069         107 MAAQIADGMAYIERMNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHhCCEeecccCcceEE
Confidence            4568999999999999999999999986


No 232
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin. Serine/threonine kinases (STKs), class IIIA myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. In photoreceptor cells, they may also function as cargo carriers during light-dependent translocation of proteins such as transducin and arrestin. Class IIIA myosin is highly expressed in retina and in inner ear
Probab=85.71  E-value=0.41  Score=41.09  Aligned_cols=28  Identities=11%  Similarity=0.052  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|+|.++++|+
T Consensus       129 ~~~~i~~~l~~lH~~~i~H~dlkp~nil  156 (286)
T cd06638         129 ILHEALMGLQHLHVNKTIHRDVKGNNIL  156 (286)
T ss_pred             HHHHHHHHHHHHHhCCccccCCCHHhEE
Confidence            4578899999999999999999999985


No 233
>COG0515 SPS1 Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair]
Probab=85.69  E-value=0.44  Score=38.29  Aligned_cols=32  Identities=16%  Similarity=0.117  Sum_probs=27.5

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ......+|+.+|++||.+.|+|||.|+.+|+.
T Consensus       103 ~~~~~~~~~~~l~~~H~~~~~hrd~kp~nil~  134 (384)
T COG0515         103 ALFILAQILSALEYLHSKGIIHRDIKPENILL  134 (384)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeccCCCHHHeee
Confidence            34456788999999999999999999999975


No 234
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Ste20-like kinase (SLK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of the subfamily include SLK, STK10 (also called LOK for lymphocyte-oriented kinase), SmSLK (Schistosoma mansoni SLK), and related proteins. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It also plays a role in mediating actin reorganization. STK10 is responsible in regulating the CD28 responsive element in T cells, as well as leukocyte function associated anti
Probab=85.63  E-value=0.4  Score=41.15  Aligned_cols=31  Identities=13%  Similarity=0.099  Sum_probs=27.1

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~~~ql~~~l~~lh~~~i~h~dl~p~nil  135 (280)
T cd06611         105 IRYVCRQMLEALNFLHSHKVIHRDLKAGNIL  135 (280)
T ss_pred             HHHHHHHHHHHHHHHHHCCcccCCCChhhEE
Confidence            3445678999999999999999999999976


No 235
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1. Protein Tyrosine Kinase (PTK) family; Janus kinase 1 (Jak1); catalytic (c) domain (repeat 2). The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Jak1 is a member of the Janus kinase (Jak) subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal FERM domain, followed by a Src homology 2 (SH2) domain, a pseudokinase domain, and a C-terminal tyr kinase domain. Jaks are crucial for cytokine receptor signaling. They are activated by autophosphorylation upon cytokine-induced receptor aggregation, and subsequently trigger downstream signaling events such as the phosphorylation of signal transducers a
Probab=85.56  E-value=0.35  Score=41.88  Aligned_cols=29  Identities=14%  Similarity=0.117  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+..|.+||+..|+|+|.+++||+
T Consensus       113 ~i~~~i~~aL~~lH~~gi~H~dlkp~Nil  141 (284)
T cd05079         113 KYAVQICKGMDYLGSRQYVHRDLAARNVL  141 (284)
T ss_pred             HHHHHHHHHHHHHHHCCeeecccchheEE
Confidence            34578999999999999999999999998


No 236
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase. Protein Tyrosine Kinase (PTK) family; Csk homologous kinase (Chk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Csk subfamily kinases are cytoplasmic (or nonreceptor) tyr kinases containing the Src homology domains, SH3 and SH2, N-terminal to the catalytic tyr kinase domain. They negatively regulate the activity of Src kinases that are anchored to the plasma membrane. Chk is also referred to as megakaryocyte-associated tyrosine kinase (Matk). To inhibit Src kinases, Chk is translocated to the membrane via binding to specific transmembrane proteins, G-proteins, or adaptor proteins near the membrane. Chk inhibit Src ki
Probab=85.55  E-value=0.38  Score=40.70  Aligned_cols=28  Identities=18%  Similarity=0.182  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~qi~~al~~lH~~~~~H~dl~p~nil  132 (254)
T cd05083         105 FSLDVAEGMEYLESKKLVHRDLAARNIL  132 (254)
T ss_pred             HHHHHHHHHHHHHhCCeeccccCcceEE
Confidence            3568999999999999999999999985


No 237
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase. Serine/Threonine Kinases (STKs), Cell Cycle-Related Kinase (CCRK) p42 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CCRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CCRK was previously called p42. It is a Cyclin-Dependent Kinase (CDK)-Activating Kinase (CAK) which is essential for the activation of CDK2. It is indispensable for cell growth and has been implicated in the progression of glioblastoma multiforme. In the heart, a splice variant of CCRK with a different C-terminal half is expressed, this variant promotes cardiac cell growth and survival and is significantly down-regulated during the development of hea
Probab=85.39  E-value=0.41  Score=40.87  Aligned_cols=30  Identities=7%  Similarity=0.073  Sum_probs=26.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       102 ~~~~~~i~~~l~~lH~~~i~H~dl~p~ni~  131 (286)
T cd07832         102 KSYMRMLLKGVAYMHANGIMHRDLKPANLL  131 (286)
T ss_pred             HHHHHHHHHHHHHHHHCCeecCCcCHHHEE
Confidence            344578999999999999999999999986


No 238
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85. Serine/Threonine Kinases (STKs), Pho85 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Pho85 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Pho85 is a multifunctional Cyclin-Dependent protein Kinase (CDK) in yeast. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. Pho85 is regulated by 10 different cyclins (Pcls) and plays a role in G1 progression, cell polarity, phosphate and glycogen metabolism, gene expression, and in signaling changes in the environment. 
Probab=85.39  E-value=0.41  Score=40.93  Aligned_cols=30  Identities=3%  Similarity=0.004  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|+|.++.+|+
T Consensus       103 ~~~~~qi~~~l~~lH~~~i~h~dl~p~ni~  132 (284)
T cd07836         103 KSFTYQLLKGIAFCHENRVLHRDLKPQNLL  132 (284)
T ss_pred             HHHHHHHHHHHHHHHHCCeeeCCCCHHHEE
Confidence            344578999999999999999999999986


No 239
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2. Protein kinases (PKs), MAP/ERK Kinase (MEK) 2 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK2 is a dual-specificity PK that phosphorylates and activates the downst
Probab=85.30  E-value=0.42  Score=42.97  Aligned_cols=28  Identities=18%  Similarity=0.237  Sum_probs=24.6

Q ss_pred             hhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++ .|+|+|.+++|||
T Consensus       108 ~~~~i~~~l~~lH~~~~ivH~dlkp~Nil  136 (331)
T cd06649         108 VSIAVLRGLAYLREKHQIMHRDVKPSNIL  136 (331)
T ss_pred             HHHHHHHHHHHHhhcCCEEcCCCChhhEE
Confidence            357899999999986 5999999999986


No 240
>PTZ00024 cyclin-dependent protein kinase; Provisional
Probab=85.30  E-value=0.42  Score=42.63  Aligned_cols=30  Identities=17%  Similarity=0.082  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.|||
T Consensus       122 ~~~~~ql~~aL~~LH~~~i~H~dl~~~nil  151 (335)
T PTZ00024        122 KCILLQILNGLNVLHKWYFMHRDLSPANIF  151 (335)
T ss_pred             HHHHHHHHHHHHHHHhCCeecccccHHHeE
Confidence            445678999999999999999999999986


No 241
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 3 (MEKK3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK3 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates the MAPK kinase MEK5 (or MKK5), which in turn phosphorylates and activates extracellular signal-regulated kinase 5 (ERK5). The ERK5 cascade plays roles in promoting cell proliferation, differentiation, neuronal survival, and neuroprotection. MEKK3 plays an essential role in embryonic angiogenesis and early heart development
Probab=85.29  E-value=0.45  Score=40.64  Aligned_cols=29  Identities=14%  Similarity=0.200  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       110 ~~~~qi~~~l~~LH~~~i~H~~l~p~nil  138 (266)
T cd06651         110 KYTRQILEGMSYLHSNMIVHRDIKGANIL  138 (266)
T ss_pred             HHHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            44678999999999999999999999987


No 242
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 is required for the transition from metaphase to anaphase. It also plays important roles in mitotic spindle formation and cytokinesis.  Activated by Nek9 during mitosis, Nek6 phosphorylates Eg5, a kinesin that is important for spindle bipolarity. Nek6 localizes to spindle microtubules during metaphase
Probab=85.25  E-value=0.47  Score=40.20  Aligned_cols=29  Identities=7%  Similarity=0.110  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       110 ~~~~~i~~~l~~LH~~~i~H~dl~~~nil  138 (267)
T cd08228         110 KYFVQLCSAVEHMHSRRVMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHhhCCeeCCCCCHHHEE
Confidence            44568999999999999999999999987


No 243
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 1 (FGFR1); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR1 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=85.23  E-value=0.43  Score=42.03  Aligned_cols=28  Identities=11%  Similarity=0.086  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       145 ~~~qi~~aL~~lH~~gi~H~dlkp~Nil  172 (307)
T cd05098         145 CAYQVARGMEYLASKKCIHRDLAARNVL  172 (307)
T ss_pred             HHHHHHHHHHHHHHCCcccccccHHheE
Confidence            3578899999999999999999999987


No 244
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). They can be classified into two classes (EphA and EphB), according to their extracellular sequences, which largely correspond to binding preferences for either GPI-anchored ephrin-A ligands or transmembrane ephrin-B ligands. Vertebrates have ten EphA and six EhpB receptors, which display promiscuous ligand interactions within each class. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment
Probab=85.23  E-value=0.37  Score=41.03  Aligned_cols=29  Identities=21%  Similarity=0.154  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.|||
T Consensus       110 ~~~~~l~~~l~~Lh~~~i~H~di~p~nil  138 (266)
T cd05033         110 GMLRGIASGMKYLSEMNYVHRDLAARNIL  138 (266)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCcceEE
Confidence            34467889999999999999999999987


No 245
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; class EphB receptors; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). Class EphB receptors bind to transmembrane ephrin-B ligands. There are six vertebrate EhpB receptors (EphB1-6), which display promiscuous interactions with three ephrin-B ligands. One exception is EphB2, which also interacts with ephrin A5. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephr
Probab=85.18  E-value=0.39  Score=41.01  Aligned_cols=29  Identities=17%  Similarity=0.141  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.+++||+
T Consensus       110 ~i~~~l~~al~~lH~~g~~H~dl~p~nil  138 (269)
T cd05065         110 GMLRGIAAGMKYLSEMNYVHRDLAARNIL  138 (269)
T ss_pred             HHHHHHHHHHHHHHHCCEeecccChheEE
Confidence            34468889999999999999999999986


No 246
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase. Protein Tyrosine Kinase (PTK) family; Tyrosine kinase expressed in hepatocellular carcinoma (Tec) and Resting lymphocyte kinase (Rlk); catalytic (c) domain. The PTKc family is part of a larger superfamily, that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Tec and Rlk (also named Txk) are members of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin h
Probab=85.16  E-value=0.38  Score=40.72  Aligned_cols=28  Identities=11%  Similarity=0.105  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|+|.++.||+
T Consensus       105 ~~~~i~~~l~~lH~~~i~H~dl~p~ni~  132 (256)
T cd05114         105 MCQDVCEGMEYLERNSFIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHCCccccccCcceEE
Confidence            3467899999999999999999999986


No 247
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Human Fyn-related kinase (Frk) and similar proteins; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Frk and Srk are members of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins a
Probab=85.10  E-value=0.4  Score=40.74  Aligned_cols=29  Identities=17%  Similarity=0.173  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.||+
T Consensus       107 ~~~~~i~~~l~~lH~~~i~H~dl~p~Nil  135 (261)
T cd05068         107 DMAAQVASGMAYLEAQNYIHRDLAARNVL  135 (261)
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCCcceEE
Confidence            44568999999999999999999999987


No 248
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase kinase 3 (MAPKKKK3 or MAP4K3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAP4K3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily includes MAP4K3, MAP4K1, MAP4K2, MAP4K5, and related proteins. Vertebrate members contain an N-terminal catalytic domain and a C-terminal citron homology (CNH) regulatory domain, similar to MAP4K4/6. MAP4Ks are involved in some MAPK signaling pathways that are important in mediating cellular responses to extracellular signals by activ
Probab=85.08  E-value=0.42  Score=40.16  Aligned_cols=29  Identities=14%  Similarity=0.051  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~~ql~~~l~~lh~~~i~h~dl~p~ni~  133 (262)
T cd06613         105 YVCRETLKGLAYLHETGKIHRDIKGANIL  133 (262)
T ss_pred             HHHHHHHHHHHHHHhCCceecCCChhhEE
Confidence            34567899999999999999999999975


No 249
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 1 (CDK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDK1 from higher eukaryotes, plants, and yeasts, as well as CDK2 and CDK3. CDK1 is also called Cell division control protein 2 (Cdc2) or p34 protein kinase, and is regulated by cyclins A, B, and E. The CDK1/cyc
Probab=85.05  E-value=0.47  Score=40.69  Aligned_cols=30  Identities=3%  Similarity=-0.001  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|++.++.+|+
T Consensus       102 ~~~~~~i~~~L~~lH~~~~~H~dl~p~nil  131 (283)
T cd07835         102 KSYLYQLLQGIAYCHSHRVLHRDLKPQNLL  131 (283)
T ss_pred             HHHHHHHHHHHHHHHHCCeeCCCCCHHHEE
Confidence            445678999999999999999999999975


No 250
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Epidermal Growth Factor Receptor (EGFR) subfamily; catalytic (c) domain. EGFR (HER, ErbB) subfamily members include EGFR (HER1, ErbB1), HER2 (ErbB2), HER3 (ErbB3), HER4 (ErbB4), and similar proteins. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. The EGFR proteins are receptor tyr kinases (RTKs) containing an extracellular EGF-related ligand-binding region, a transmembrane helix, and a cytoplasmic region with a tyr kinase domain and a regulatory C-terminal tail. Unlike other tyr kinases, phosphorylation of the activation loop of EGFR proteins is not critical to their activation. Instea
Probab=85.03  E-value=0.37  Score=41.46  Aligned_cols=29  Identities=14%  Similarity=0.185  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|+++.||+
T Consensus       113 ~~~~qi~~~l~~LH~~~i~H~di~p~nil  141 (279)
T cd05057         113 NWCVQIAKGMSYLEEKRLVHRDLAARNVL  141 (279)
T ss_pred             HHHHHHHHHHHHHHhCCEEecccCcceEE
Confidence            34468999999999999999999999986


No 251
>PLN00009 cyclin-dependent kinase A; Provisional
Probab=84.97  E-value=0.41  Score=41.53  Aligned_cols=29  Identities=3%  Similarity=0.020  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|++.++.||+
T Consensus       106 ~~~~qi~~aL~~LH~~~i~H~dl~p~nil  134 (294)
T PLN00009        106 TYLYQILRGIAYCHSHRVLHRDLKPQNLL  134 (294)
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCCCcceEE
Confidence            34468999999999999999999999876


No 252
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase. Serine/Threonine Kinases (STKs), MAPK/MAK/MRK Overlapping Kinase (MOK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MOK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MOK, also called Renal tumor antigen 1 (RAGE-1), is widely expressed and is enriched in testis, kidney, lung, and brain. It is expressed in approximately 50% of renal cell carcinomas (RCC) and is a potential target for immunotherapy. MOK is stabilized by its association with the HSP90 molecular chaperone. It is induced by the transcription factor Cdx2 and may be involved in regulating intestinal epithelial development and differentiation.
Probab=84.92  E-value=0.44  Score=40.61  Aligned_cols=28  Identities=11%  Similarity=0.116  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.+|+
T Consensus       105 ~~~qi~~~L~~LH~~~i~H~dl~p~ni~  132 (282)
T cd07831         105 YMYQLLKSLDHMHRNGIFHRDIKPENIL  132 (282)
T ss_pred             HHHHHHHHHHHHHHCCceecccCHHHEE
Confidence            4478999999999999999999999986


No 253
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) alpha; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR alpha is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR alpha forms homodimers or heterodimers with PDGFR beta, depending on the nature of the PDGF ligand. PDGF-AA, PDGF-
Probab=84.89  E-value=0.46  Score=45.16  Aligned_cols=29  Identities=14%  Similarity=0.099  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|+++.|||
T Consensus       241 ~~~~qi~~aL~~LH~~~ivH~dikp~Nil  269 (400)
T cd05105         241 SFTYQVARGMEFLASKNCVHRDLAARNVL  269 (400)
T ss_pred             HHHHHHHHHHHHHHhCCeeCCCCChHhEE
Confidence            45578999999999999999999999986


No 254
>smart00219 TyrKc Tyrosine kinase, catalytic domain. Phosphotransferases. Tyrosine-specific kinase subfamily.
Probab=84.79  E-value=0.42  Score=39.79  Aligned_cols=30  Identities=17%  Similarity=0.137  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~~ql~~~l~~lh~~~~~h~dl~~~nil  135 (258)
T smart00219      106 LSFALQIARGMEYLESKNFIHRDLAARNCL  135 (258)
T ss_pred             HHHHHHHHHHHHHHhcCCeeecccccceEE
Confidence            345578999999999999999999999985


No 255
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional
Probab=84.76  E-value=0.47  Score=41.14  Aligned_cols=31  Identities=6%  Similarity=0.124  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||+..|+|+|.++.+|+
T Consensus       111 ~~~~~~qi~~~l~~lH~~~i~H~dl~p~nil  141 (267)
T PHA03390        111 VKKIIRQLVEALNDLHKHNIIHNDIKLENVL  141 (267)
T ss_pred             HHHHHHHHHHHHHHHHhCCeeeCCCCHHHEE
Confidence            3445678999999999999999999999986


No 256
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase. Serine/Threonine Kinases (STKs), G protein-coupled Receptor Kinase (GRK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The GRK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. GRKs phosphorylate and regulate G protein-coupled receptors (GPCRs), the largest superfamily of cell surface receptors, which regulate some part of nearly all physiological functions. Phosphorylated GPCRs bind to arrestins, which prevents further G protein signaling despite the presence of activating ligand. GRKs contain a central catalytic domain, flanked by N- and C-terminal extensions. The N-terminus contains an RGS (regulator of 
Probab=84.76  E-value=0.51  Score=40.69  Aligned_cols=28  Identities=14%  Similarity=0.205  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|+++.||+
T Consensus       100 ~~~ql~~~l~~lH~~~i~H~di~p~Nil  127 (277)
T cd05577         100 YAAQIICGLEHLHQRRIVYRDLKPENVL  127 (277)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            3468999999999999999999999986


No 257
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs),  (Cdc7)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Cdc7-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this subfamily include Schizosaccharomyces pombe Cdc7, Saccharomyces cerevisiae Cdc15, Arabidopsis thaliana mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) epsilon, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Fission yeast 
Probab=84.74  E-value=0.5  Score=39.23  Aligned_cols=28  Identities=21%  Similarity=0.177  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 ~~~~i~~~l~~lH~~~i~H~dl~p~ni~  131 (254)
T cd06627         104 YVYQVLQGLAYLHEQGVIHRDIKAANIL  131 (254)
T ss_pred             HHHHHHHHHHHHhhCCcccCCCCHHHEE
Confidence            4478999999999999999999999986


No 258
>KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms]
Probab=84.72  E-value=0.32  Score=50.70  Aligned_cols=27  Identities=11%  Similarity=0.149  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|..+..|||.|.|||+|.|+-|||
T Consensus       494 AqQiaqGM~YLHAK~IIHrDLKSnNIF  520 (678)
T KOG0193|consen  494 AQQIAQGMDYLHAKNIIHRDLKSNNIF  520 (678)
T ss_pred             HHHHHHhhhhhhhhhhhhhhccccceE
Confidence            368889999999999999999999997


No 259
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 5 (Nek5) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek5 subfamily is one of a family of 11 different Neks (Nek1-11). The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Neks are involved in the regulation of downstream processes following the activation of Cdc2, and many of their functions are cell cycle-related. They play critical roles in microtubule dynamics during ciliogenesis and mitosis. The specific function of Nek5 is unknown.
Probab=84.66  E-value=0.46  Score=39.75  Aligned_cols=29  Identities=14%  Similarity=0.147  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       105 ~~~~~l~~~l~~lh~~~i~H~dl~~~nil  133 (257)
T cd08225         105 SWFVQISLGLKHIHDRKILHRDIKSQNIF  133 (257)
T ss_pred             HHHHHHHHHHHHHHHCCcccccCCHHHEE
Confidence            34467999999999999999999999987


No 260
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src. Protein Tyrosine Kinase (PTK) family; Src kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) is a cytoplasmic (or non-receptor) tyr kinase, containing an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region with a conserved tyr. It is activated by autophosphorylation at the tyr kinase domain, and is negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). c-Src is the vertebrate homolog of the oncogenic protein (v-Src) from Rous sarcoma virus. Together with other Src subfamily proteins, it is invo
Probab=84.63  E-value=0.46  Score=40.76  Aligned_cols=29  Identities=17%  Similarity=0.140  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.||+
T Consensus       106 ~~~~~l~~aL~~lH~~~i~H~dl~p~Nil  134 (262)
T cd05071         106 DMAAQIASGMAYVERMNYVHRDLRAANIL  134 (262)
T ss_pred             HHHHHHHHHHHHHHHCCccccccCcccEE
Confidence            34578999999999999999999999985


No 261
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn. Protein Tyrosine Kinase (PTK) family; Lyn kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Lyn is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pathways that regulate cytokine and growth fa
Probab=84.57  E-value=0.46  Score=40.21  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       108 ~~~~l~~~l~~LH~~~i~H~dl~p~nil  135 (261)
T cd05072         108 FSAQIAEGMAYIERKNYIHRDLRAANVL  135 (261)
T ss_pred             HHHHHHHHHHHHHHCCeeccccchhhEE
Confidence            3468999999999999999999999986


No 262
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase. Serine/threonine kinases (STKs), Ste20-like kinase (SLK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The SLK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SLK promotes apoptosis through apoptosis signal-regulating kinase 1 (ASK1) and the mitogen-activated protein kinase (MAPK) p38. It acts as a MAPK kinase kinase (MAPKKK) by phosphorylating ASK1, resulting in the phosphorylation of p38. SLK also plays a role in mediating actin reorganization. It is part of a microtubule-associated complex that is targeted at adhesion sites, and is required in focal adhesion turnover and in regulating cell migration.
Probab=84.57  E-value=0.44  Score=41.06  Aligned_cols=29  Identities=14%  Similarity=0.146  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||...|+|+|.++.||+
T Consensus       107 ~~~~qi~~~L~~LH~~~i~H~dlkp~nil  135 (282)
T cd06643         107 VVCKQTLEALNYLHENKIIHRDLKAGNIL  135 (282)
T ss_pred             HHHHHHHHHHHHHHHCCeeecCCCcccEE
Confidence            34568999999999999999999999985


No 263
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 1, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK1 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=84.54  E-value=0.51  Score=41.56  Aligned_cols=32  Identities=13%  Similarity=0.117  Sum_probs=27.7

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +......+|+.+|.+||++.|+|+|.++.||+
T Consensus       117 ~~~~i~~ql~~aL~~LH~~gi~H~dLkp~Nil  148 (296)
T cd06654         117 QIAAVCRECLQALEFLHSNQVIHRDIKSDNIL  148 (296)
T ss_pred             HHHHHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            33455678999999999999999999999986


No 264
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group II, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. Group II PAKs, also called non-conventional PAKs, include PAK4, PAK5, and PAK6. Group II PAKs contain PBD (p21-binding domain) and catalytic domains, but lack other motifs foun
Probab=84.42  E-value=0.48  Score=41.35  Aligned_cols=28  Identities=18%  Similarity=0.178  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       120 ~~~ql~~~l~~lH~~~i~H~dl~p~Nil  147 (285)
T cd06648         120 VCLAVLKALSFLHAQGVIHRDIKSDSIL  147 (285)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCChhhEE
Confidence            4478999999999999999999999985


No 265
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; most class EphA receptors including EphA3, EphA4, EphA5, and EphA7, but excluding EphA1, EphA2 and EphA10; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. One exception is EphA4, which also binds ephrins-B2/B3. EphRs contain an ephrin-binding domain and two fibronectin repeats extracellul
Probab=84.38  E-value=0.4  Score=41.00  Aligned_cols=29  Identities=21%  Similarity=0.150  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.|||
T Consensus       110 ~i~~~i~~~l~~lH~~~i~h~dlkp~nil  138 (267)
T cd05066         110 GMLRGIASGMKYLSDMGYVHRDLAARNIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHHCCEeehhhchhcEE
Confidence            34467899999999999999999999985


No 266
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 3 (Nek3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek3 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek3 is primarily localized in the cytoplasm and shows no cell cycle-dependent changes in its activity. It is present in the axons of neurons and affects morphogenesis and polarity through its regulation of microtubule acetylation. Nek3 modulates the signaling of the prolactin receptor through its activati
Probab=84.36  E-value=0.47  Score=40.02  Aligned_cols=29  Identities=3%  Similarity=0.045  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|+|.++.+|+
T Consensus       104 ~~~~~i~~al~~lH~~~i~H~dl~p~nil  132 (255)
T cd08219         104 QWFVQMCLGVQHIHEKRVLHRDIKSKNIF  132 (255)
T ss_pred             HHHHHHHHHHHHHhhCCcccCCCCcceEE
Confidence            34578999999999999999999999985


No 267
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 4 (MAPK4) and MAPK6 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK4/6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. MAPK4 is also called ERK4 or p63MAPK, while MAPK6 is also called ERK3 or p97MAPK. MAPK4 and MAPK6 are atypical MAPKs that are not regulated by MAP2Ks. MAPK6 is expressed ubiquitously with highest amounts in brain and skeletal muscle. It may be involved in the control of cell differentiation by negatively regulating cell cycle progressi
Probab=84.32  E-value=0.52  Score=42.58  Aligned_cols=30  Identities=7%  Similarity=0.048  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+++|++||+..|+|+++++.|||
T Consensus       117 ~~~~~qi~~aL~~LH~~givH~dikp~Nil  146 (342)
T cd07854         117 RLFMYQLLRGLKYIHSANVLHRDLKPANVF  146 (342)
T ss_pred             HHHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            345678999999999999999999999986


No 268
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Male germ cell-Associated Kinase (MAK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of human MAK and MAK-related kinase (MRK), Saccharomyces cerevisiae Ime2p, Schizosaccharomyces pombe Mei4-dependent protein 3 (Mde3) and Pit1, Caenorhabditis elegans dyf-5, Arabidopsis thaliana MHK, and similar proteins. These proteins play important roles during meiosis. MAK is highly expressed in testicular cells specifically in the meiotic phase, but is not essential for spermatogenesis and fertili
Probab=84.20  E-value=0.53  Score=40.25  Aligned_cols=31  Identities=10%  Similarity=0.055  Sum_probs=27.2

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ......+|+.+|.+||++.|+|+|.++.+|+
T Consensus       101 ~~~~~~~l~~~l~~Lh~~~i~H~dl~~~ni~  131 (283)
T cd07830         101 IRSIIYQILQGLAHIHKHGFFHRDLKPENLL  131 (283)
T ss_pred             HHHHHHHHHHHHHHHHHCCcccCCCChhhEE
Confidence            3445679999999999999999999999986


No 269
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1. Serine/Threonine Kinases (STKs), Fungal Mitogen-Activated Protein Kinase (MAPK) Sty1/Hog1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sty1/Hog1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of the MAPKs Sty1 from Schizosaccharomyces pombe, Hog1 from Saccharomyces cerevisiae, and similar proteins. MAPKs are important mediators of cellular responses to extracellular signals. Sty1 and Hog1 are stress-activated MAPKs that partipate in transcriptional regulation in response to stress. Sty1 is activated in response to oxidative stress, osmotic stress, and U
Probab=84.17  E-value=0.54  Score=42.44  Aligned_cols=29  Identities=10%  Similarity=0.071  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||++.|+|++.++.||+
T Consensus       112 ~~~~ql~~aL~~LH~~~iiH~dl~p~Nil  140 (328)
T cd07856         112 YFLYQILRGLKYVHSAGVVHRDLKPSNIL  140 (328)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCCCHHHEe
Confidence            45678999999999999999999999986


No 270
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs serve as important mediators of cellular responses to extracellular signals. They control critical cellular functions including differentiation, proliferation, migration, and apoptosis. They are also implicated in the pathogenesis of many diseases including multiple types of cancer, stroke, diabetes, and chronic inflammation. Typical MAPK pathways involve a triple kinase core cascade comprising of the MAPK, which is phosphorylated and
Probab=84.15  E-value=0.54  Score=41.60  Aligned_cols=28  Identities=14%  Similarity=0.134  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||+..|+|+|.++.|||
T Consensus       108 i~~~l~~~l~~LH~~gi~H~dlkp~nil  135 (330)
T cd07834         108 FLYQILRGLKYLHSANVIHRDLKPSNIL  135 (330)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            4578999999999999999999999986


No 271
>KOG4645 consensus MAPKKK (MAP kinase kinase kinase) SSK2 and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=83.94  E-value=0.49  Score=53.06  Aligned_cols=28  Identities=14%  Similarity=0.202  Sum_probs=26.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-+++++|.+||+..|.|||+|+||||
T Consensus      1339 yt~qll~gla~LH~~gIVHRDIK~aNI~ 1366 (1509)
T KOG4645|consen 1339 YTKQLLEGLAYLHEHGIVHRDIKPANIL 1366 (1509)
T ss_pred             HHHHHHHHHHHHHhcCceecCCCcccee
Confidence            3568999999999999999999999997


No 272
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 2 (CDK2) and CDK3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK2/3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK2 is regulated by cyclin E or cyclin A. Upon activation by cyclin E, it phosphorylates the retinoblastoma (pRb) protein which activates E2F mediated transcription and allows cells to move into S phase. The CDK2/cyclin A complex 
Probab=83.91  E-value=0.53  Score=40.38  Aligned_cols=29  Identities=7%  Similarity=0.015  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~lh~~~i~H~~l~p~nil  132 (284)
T cd07860         104 SYLFQLLQGLAFCHSHRVLHRDLKPQNLL  132 (284)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            34567999999999999999999999976


No 273
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer. Protein Tyrosine Kinase (PTK) family; Fer kinase; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Fer kinase is a member of the Fes subfamily of proteins which are cytoplasmic (or nonreceptor) tyr kinases containing an N-terminal region with FCH (Fes/Fer/CIP4 homology) and coiled-coil domains, followed by a SH2 domain, and a C-terminal catalytic domain. Fer kinase is expressed in a wide variety of tissues, and is found to reside in both the cytoplasm and the nucleus. It plays important roles in neuronal polarization and neurite development, cytoskeletal reorganization, cell migration, growth factor signaling, and the regulation of cell-c
Probab=83.90  E-value=0.48  Score=39.76  Aligned_cols=28  Identities=11%  Similarity=0.014  Sum_probs=25.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+..|.+||++.|+|+|.+++||+
T Consensus        98 ~~~~i~~~l~~lH~~~~~H~dl~p~nil  125 (250)
T cd05085          98 FALDAAAGMAYLESKNCIHRDLAARNCL  125 (250)
T ss_pred             HHHHHHHHHHHHHhCCeeecccChheEE
Confidence            3467889999999999999999999976


No 274
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 1 (MST1) and MST2 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST1/2 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST1, MST2, and related proteins including Drosophila Hippo and Dictyostelium discoideum Krs1 (kinase responsive to stress 1). MST1/2 and Hippo are involved in a conserved pathway that governs cell contact inhibition, organ size control, and tumor development. MST1 activates the mitogen-activated protein kinases (MAPKs) p38 and c-Jun N-terminal kinase (JNK) through MKK7 (a 
Probab=83.83  E-value=0.5  Score=39.54  Aligned_cols=29  Identities=14%  Similarity=0.067  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|++.++.+|+
T Consensus       103 ~~~~~l~~~l~~lh~~~i~H~dl~~~ni~  131 (256)
T cd06612         103 AILYQTLKGLEYLHSNKKIHRDIKAGNIL  131 (256)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCCcceEE
Confidence            34578899999999999999999999986


No 275
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38gamma subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38gamma subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38gamma, also called MAPK12
Probab=83.82  E-value=0.56  Score=42.50  Aligned_cols=29  Identities=3%  Similarity=0.074  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       122 ~i~~qi~~al~~LH~~gi~H~dlkp~Nil  150 (343)
T cd07880         122 FLVYQMLKGLKYIHAAGIIHRDLKPGNLA  150 (343)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            34578999999999999999999999985


No 276
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4. Protein Tyrosine Kinase (PTK) family; Fibroblast Growth Factor Receptor 4 (FGFR4); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. FGFR4 is part of the FGFR subfamily, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with three immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of FGFRs to their ligands, the FGFs, results in receptor dimerization and activation, and intracellular signaling. The binding of FGFs to FGFRs is promiscuous, in that a receptor may be activated by several ligands and a ligand may bind to
Probab=83.70  E-value=0.47  Score=42.05  Aligned_cols=27  Identities=11%  Similarity=0.135  Sum_probs=25.1

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.|||
T Consensus       140 ~~qi~~aL~~lH~~gi~H~dlkp~Nil  166 (314)
T cd05099         140 AYQVARGMEYLESRRCIHRDLAARNVL  166 (314)
T ss_pred             HHHHHHHHHHHHHCCeeeccccceeEE
Confidence            468999999999999999999999986


No 277
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38delta subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38delta subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38delta, also called MAPK13
Probab=83.70  E-value=0.58  Score=42.29  Aligned_cols=28  Identities=4%  Similarity=0.124  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.|||
T Consensus       122 ~~~qi~~aL~~LH~~~i~H~dlkp~NIl  149 (342)
T cd07879         122 LVYQMLCGLKYIHSAGIIHRDLKPGNLA  149 (342)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            4578999999999999999999999985


No 278
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 2 (Nek2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek2 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek2 subfamily includes Aspergillus nidulans NIMA kinase, the founding member of the Nek family, which was identified in a screen for cell cycle mutants prevented from entering mitosis. NIMA is essential for mitotic entry and progression through mitosis, and its degradation is essential for mitotic exi
Probab=83.63  E-value=0.59  Score=38.92  Aligned_cols=30  Identities=17%  Similarity=0.073  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhc-----cccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQ-----NQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~-----~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||     +..|+|+|.++.||+
T Consensus       108 ~~~~~~i~~~l~~lH~~~~~~~~i~h~dl~p~nil  142 (265)
T cd08217         108 WRILTQLLLALYECHNRSDPGNTVLHRDLKPANIF  142 (265)
T ss_pred             HHHHHHHHHHHHHHhcCccccCcceecCCCHHHEE
Confidence            345678999999999     999999999999986


No 279
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=83.57  E-value=0.35  Score=38.38  Aligned_cols=9  Identities=33%  Similarity=0.693  Sum_probs=0.0

Q ss_pred             CCceecCCC
Q 024658          132 ENQVVPWSG  140 (264)
Q Consensus       132 enqvVp~s~  140 (264)
                      |.+.+|+-+
T Consensus        49 eee~m~rK~   57 (81)
T PF14812_consen   49 EEEPMPRKG   57 (81)
T ss_dssp             ---------
T ss_pred             hcccccccc
Confidence            444566655


No 280
>KOG1164 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]
Probab=83.56  E-value=0.56  Score=42.94  Aligned_cols=25  Identities=8%  Similarity=0.170  Sum_probs=23.4

Q ss_pred             HHHHHhhhhccccccccCcchhhhH
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++++.|+.||+..++|||+|++|++
T Consensus       130 q~l~~l~~lH~~G~iHRDiKp~N~~  154 (322)
T KOG1164|consen  130 QNLNALEDLHSKGFIHRDIKPENFV  154 (322)
T ss_pred             HHHHHHHHHHhcCcccCCcCHHHee
Confidence            7889999999999999999999975


No 281
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15. Serine/Threonine Kinases (STKs), Mitogen-Activated Protein Kinase 15 (MAPK15) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPK15 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. Human MAPK15 is also called Extracellular signal Regulated Kinase 8 (ERK8) while the rat protein is called ERK7. ERK7 and ERK8 display both similar and different biochemical properties. They autophosphorylate and activate themselves and do not require upstream activating kinases. ERK7 is constitutively active and is not affected by extracellular stimul
Probab=83.54  E-value=0.51  Score=42.21  Aligned_cols=28  Identities=7%  Similarity=0.126  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.++.|||
T Consensus       112 i~~qi~~~L~~LH~~~i~H~dl~p~nil  139 (337)
T cd07852         112 IMYQLLKALKYIHSGNVIHRDLKPSNIL  139 (337)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            4578899999999999999999999976


No 282
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants. Serine/Threonine Kinases (STKs), Plant TEY Mitogen-Activated Protein Kinase (MAPK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TEY MAPK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKs are important mediators of cellular responses to extracellular signals. In plants, MAPKs are associated with physiological, developmental, hormonal, and stress responses. Some plants show numerous gene duplications of MAPKs. Arabidopsis thaliana harbors at least 20 MAPKs, named AtMPK1-20. There are two subtypes of plant MAPKs based on the conserved phosphorylation motif present in the activati
Probab=83.41  E-value=0.6  Score=42.01  Aligned_cols=30  Identities=3%  Similarity=0.040  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|++||++.|+|++.++.||+
T Consensus       111 ~~i~~qi~~aL~~LH~~~i~H~dlkp~Nil  140 (337)
T cd07858         111 QYFLYQLLRGLKYIHSANVLHRDLKPSNLL  140 (337)
T ss_pred             HHHHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            445678999999999999999999999985


No 283
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Byr2-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Schizosaccharomyces pombe Byr2, Saccharomyces cerevisiae and Cryptococcus neoformans Ste11, and related proteins. They contain an N-terminal SAM (sterile alpha-motif) domain, which mediates protein-protein interaction, and a C-terminal catalytic domain. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate
Probab=83.41  E-value=0.62  Score=39.49  Aligned_cols=29  Identities=21%  Similarity=0.212  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|+|.++.+|+
T Consensus       110 ~~~~~l~~~l~~lH~~~ivH~di~p~nil  138 (267)
T cd06628         110 NFVRQILKGLNYLHNRGIIHRDIKGANIL  138 (267)
T ss_pred             HHHHHHHHHHHHHHhcCcccccCCHHHEE
Confidence            44578999999999999999999999986


No 284
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 9 (Nek9) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek9 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek9, also called Nercc1, is primarily a cytoplasmic protein but can also localize in the nucleus. It is involved in modulating chromosome alignment and splitting during mitosis. It interacts with the gamma-tubulin ring complex and the Ran GTPase, and is implicated in microtubule organization. Nek9 associa
Probab=83.38  E-value=0.6  Score=39.32  Aligned_cols=29  Identities=10%  Similarity=0.023  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.++.+|+
T Consensus       105 ~~~~~l~~~l~~lh~~~i~h~dl~p~ni~  133 (256)
T cd08221         105 WYLFQIVSAVSYIHKAGILHRDIKTLNIF  133 (256)
T ss_pred             HHHHHHHHHHHHHHhCCccccCCChHhEE
Confidence            44578899999999999999999999986


No 285
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase. Serine/Threonine Kinases (STKs), cGMP-dependent protein kinase (cGK or PKG) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The cGK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Mammals have two cGK isoforms from different genes, cGKI and cGKII. cGKI exists as two splice variants, cGKI-alpha and cGKI-beta. cGK consists of an N-terminal regulatory domain containing a dimerization and an autoinhibitory pseudosubstrate region, two cGMP-binding domains, and a C-terminal catalytic domain. Binding of cGMP to both binding sites releases the inhibition of the catalytic center by the pseudosubstrate region, allowi
Probab=83.37  E-value=0.61  Score=39.53  Aligned_cols=28  Identities=7%  Similarity=0.101  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|++||++.|+|++.++.+|+
T Consensus        98 ~~~~i~~~l~~lH~~~~~h~dl~~~nil  125 (262)
T cd05572          98 YIACVVLAFEYLHNRGIIYRDLKPENLL  125 (262)
T ss_pred             HHHHHHHHHHHHhhCCcccCCCCHHHEE
Confidence            3467999999999999999999999996


No 286
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6. Protein kinases (PKs), MAP kinase kinase 3 (MKK3) and MKK6 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK3 and MKK6 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK3 and MKK6 are dual-specificity PKs
Probab=83.28  E-value=0.63  Score=39.80  Aligned_cols=29  Identities=10%  Similarity=0.235  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+ .|+|+|.++.+||
T Consensus       107 ~~~~qi~~~l~~lH~~~~i~h~dlkp~nil  136 (283)
T cd06617         107 KIAVSIVKALEYLHSKLSVIHRDVKPSNVL  136 (283)
T ss_pred             HHHHHHHHHHHHHhhcCCeecCCCCHHHEE
Confidence            4457899999999987 8999999999986


No 287
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3. Protein Tyrosine Kinase (PTK) family; Apoptosis-associated tyrosine kinase 1 (Aatyk1) and Aatyk3; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Aatyk1 and Aatyk3 are members of the Aatyk subfamily of proteins. Aatyk3 is a receptor kinase containing a transmembrane segment and a long C-terminal cytoplasmic tail with a catalytic domain. Aatyk1 has a similar domain arrangement but without the transmembrane segment and is thus, a cytoplasmic (or nonreceptor) kinase. The expression of Aatyk1 (also referred simply as Aatyk) is upregulated during growth arrest and apoptosis in myeloid cells
Probab=83.13  E-value=0.53  Score=40.27  Aligned_cols=28  Identities=14%  Similarity=0.045  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       105 ~~~qi~~al~~lH~~~i~H~dlkp~nil  132 (269)
T cd05087         105 MACEIALGLLHLHKNNFIHSDLALRNCL  132 (269)
T ss_pred             HHHHHHHHHHHHHHCCEeccccCcceEE
Confidence            3468999999999999999999999976


No 288
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=83.03  E-value=0.6  Score=53.78  Aligned_cols=15  Identities=33%  Similarity=0.667  Sum_probs=8.7

Q ss_pred             hhccccCCceecCCC
Q 024658          126 EEEEDDENQVVPWSG  140 (264)
Q Consensus       126 ~~ee~~enqvVp~s~  140 (264)
                      +|+|+++.||-|+--
T Consensus       171 ~e~~~~~~~~~~~~d  185 (2849)
T PTZ00415        171 EEEEEEEEEIKGFDD  185 (2849)
T ss_pred             cccccccccccCCCc
Confidence            444455557777754


No 289
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4. Serine/threonine kinases (STKs), MAP/ERK kinase kinase 4 (MEKK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MEKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MEKK4 is a mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MKKK or MAP3K), that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. MEKK4 activates the c-Jun N-terminal kinase (JNK) and p38 MAPK signaling pathways by directly activating their respective MAPKKs, MKK4
Probab=83.02  E-value=0.63  Score=39.13  Aligned_cols=28  Identities=14%  Similarity=0.175  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.||+
T Consensus       104 i~~~i~~~l~~lh~~~i~H~dl~~~nil  131 (264)
T cd06626         104 YTLQLLEGLAYLHSHGIVHRDIKPANIF  131 (264)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            3478999999999999999999999985


No 290
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin. Serine/threonine kinases (STKs), class IIIB myosin subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The class III myosin subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Class III myosins are motor proteins containing an N-terminal kinase catalytic domain and a C-terminal actin-binding domain. Class III myosins may play an important role in maintaining the structural integrity of photoreceptor cell microvilli. They may also function as cargo carriers during light-dependent translocation, in photoreceptor cells, of proteins such as transducin and arrestin. Class IIIB myosin is expressed highly in retina. It is also pre
Probab=82.96  E-value=0.6  Score=40.42  Aligned_cols=28  Identities=14%  Similarity=0.135  Sum_probs=25.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||+..|+|++.++.+|+
T Consensus       133 ~~~qi~~al~~lH~~~ivH~dlkp~nil  160 (291)
T cd06639         133 ILYGALLGLQHLHNNRIIHRDVKGNNIL  160 (291)
T ss_pred             HHHHHHHHHHHHHhCCeeccCCCHHHEE
Confidence            3467899999999999999999999985


No 291
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase. Protein Tyrosine Kinase (PTK) family; Interleukin-2 (IL-2)-inducible T-cell kinase (Itk); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Itk (also known as Tsk or Emt) is a member of the Tec subfamily of proteins, which are cytoplasmic (or nonreceptor) tyr kinases with similarity to Src kinases in that they contain Src homology protein interaction domains (SH3, SH2) N-terminal to the catalytic tyr kinase domain. Unlike Src kinases, most Tec subfamily members (except Rlk) also contain an N-terminal pleckstrin homology (PH) domain, which binds the products of PI3K and allows membrane recruitment and activ
Probab=82.88  E-value=0.58  Score=39.39  Aligned_cols=29  Identities=10%  Similarity=0.069  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+..|+|+|.+++||+
T Consensus       104 ~~~~~l~~~l~~lH~~~i~h~dl~p~ni~  132 (256)
T cd05112         104 GMCLDVCEGMAYLESSNVIHRDLAARNCL  132 (256)
T ss_pred             HHHHHHHHHHHHHHHCCccccccccceEE
Confidence            34468899999999999999999999976


No 292
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38alpha subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38alpha subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK3, in response to cellular stresses or inflammatory cytokines. Vertebrates contain four isoforms of p38, named alpha, beta, gamma, and delta. p38alpha, also called MAPK14
Probab=82.87  E-value=0.58  Score=42.45  Aligned_cols=28  Identities=7%  Similarity=0.148  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.||+
T Consensus       125 i~~qi~~aL~~LH~~~ivH~dlkp~NIl  152 (345)
T cd07877         125 LIYQILRGLKYIHSADIIHRDLKPSNLA  152 (345)
T ss_pred             HHHHHHHHHHHHHHCCeeecCCChHHEE
Confidence            3468899999999999999999999986


No 293
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases. Protein Tyrosine Kinase (PTK) family; Src kinase subfamily; catalytic (c) domain. Src subfamily members include Src, Lck, Hck, Blk, Lyn, Fgr, Fyn, Yrk, and Yes. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Src (or c-Src) proteins are cytoplasmic (or non-receptor) tyr kinases which are anchored to the plasma membrane. They contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-t
Probab=82.86  E-value=0.61  Score=39.37  Aligned_cols=29  Identities=17%  Similarity=0.171  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||++.|+|+|.++.||+
T Consensus       107 ~~~~~i~~al~~lh~~~i~h~di~p~nil  135 (261)
T cd05034         107 DMAAQIAEGMAYLESRNYIHRDLAARNIL  135 (261)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCcchheEE
Confidence            44568899999999999999999999986


No 294
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta. Protein Tyrosine Kinase (PTK) family; Platelet Derived Growth Factor Receptor (PDGFR) beta; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. PDGFR beta is a receptor tyr kinase (RTK) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding to its ligands, the PDGFs, leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. PDGFR beta forms homodimers or heterodimers with PDGFR alpha, depending on the nature of the PDGF ligand. PDGF-BB and PDGF-D
Probab=82.82  E-value=0.6  Score=44.50  Aligned_cols=28  Identities=14%  Similarity=0.097  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|+|.+++|||
T Consensus       244 ~~~qi~~aL~~LH~~~ivHrdlkp~NiL  271 (401)
T cd05107         244 FSYQVANGMEFLASKNCVHRDLAARNVL  271 (401)
T ss_pred             HHHHHHHHHHHHhcCCcCcccCCcceEE
Confidence            4468999999999999999999999985


No 295
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), Nak1 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nak1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of Schizosaccharomyces pombe Nak1, Saccharomyces cerevisiae Kic1p (kinase that interacts with Cdc31p) and related proteins. Nak1 (also known as N-rich kinase 1), is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Kic1p is required by budding yeast for cell integrity and morphogenesis. Kic1p interacts with Cdc31p, the yeast homologue of cent
Probab=82.65  E-value=0.66  Score=39.63  Aligned_cols=28  Identities=14%  Similarity=0.151  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||+..|+|++.++.||+
T Consensus       106 i~~~i~~~l~~lh~~~i~H~dl~p~ni~  133 (277)
T cd06917         106 IIREVLVALKYIHKVGVIHRDIKAANIL  133 (277)
T ss_pred             HHHHHHHHHHHHHhCCcccCCcCHHHEE
Confidence            4467999999999999999999999986


No 296
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1. Serine/Threonine Kinases (STKs), Yank1 or STK32A subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Yank1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily contains uncharacterized STKs with similarity to the human protein designated Yank1 or STK32A.
Probab=82.62  E-value=0.66  Score=39.24  Aligned_cols=29  Identities=14%  Similarity=0.099  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|.|++.++.||+
T Consensus       104 ~~~~~i~~~l~~lh~~~i~h~dl~~~nil  132 (258)
T cd05578         104 FWICEIVLALEYLHSKGIIHRDIKPDNIL  132 (258)
T ss_pred             HHHHHHHHHHHHHHhCCeeccCCCHHHeE
Confidence            34578999999999999999999999987


No 297
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like 2 (CDKL2) and CDKL3 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL2 and CDKL3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKL2, also called p56 KKIAMRE, is expressed in testis, kidney, lung, and brain. It functions mainly in mature neurons and plays an important role in learning and memory. Inactivation of CDKL3, also called NKI
Probab=82.62  E-value=0.64  Score=39.79  Aligned_cols=29  Identities=7%  Similarity=0.043  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~LH~~~i~h~~l~p~ni~  132 (286)
T cd07846         104 KYLFQILRGIEFCHSHNIIHRDIKPENIL  132 (286)
T ss_pred             HHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            34568999999999999999999999986


No 298
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1. Serine/threonine kinases (STKs), plant MAP/ERK kinase kinase 1 (MEKK1)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The plant MEKK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of plant mitogen-activated protein kinase (MAPK) kinase kinases (MAPKKKs or MKKKs or MAP3Ks) including Arabidopsis thaliana MEKK1 and MAPKKK3. MEKK1 is a MAPKKK that phosphorylates and activates MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Arabidops
Probab=82.61  E-value=0.66  Score=38.75  Aligned_cols=28  Identities=18%  Similarity=0.201  Sum_probs=25.5

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.+|+
T Consensus       107 ~~~~i~~~l~~lH~~~i~H~dl~~~ni~  134 (258)
T cd06632         107 YTRQILLGLEYLHDRNTVHRDIKGANIL  134 (258)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            4568999999999999999999999985


No 299
>KOG4721 consensus Serine/threonine protein kinase, contains leucine zipper domain [Signal transduction mechanisms]
Probab=82.55  E-value=0.37  Score=50.65  Aligned_cols=30  Identities=17%  Similarity=0.169  Sum_probs=28.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++-|+.|..+++|||.-+|||||.|+-|||
T Consensus       215 v~Wsk~IA~GM~YLH~hKIIHRDLKSPNiL  244 (904)
T KOG4721|consen  215 VDWSKGIAGGMNYLHLHKIIHRDLKSPNIL  244 (904)
T ss_pred             HHHHHHhhhhhHHHHHhhHhhhccCCCceE
Confidence            377899999999999999999999999997


No 300
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 6 (Nek6) and Nek7 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek6/7 subfamily is part of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek6 and Nek7 are the shortest Neks, consisting only of the catalytic domain and a very short N-terminal extension. They show distinct expression patterns and both appear to be downstream substrates of Nek9. They are required for mitotic spindle formation and cytokinesis. They may a
Probab=82.38  E-value=0.67  Score=39.03  Aligned_cols=29  Identities=10%  Similarity=0.146  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|++.++.||+
T Consensus       110 ~~~~~l~~~l~~lh~~~i~h~dl~p~nil  138 (267)
T cd08224         110 KYFVQLCSALEHMHSKRIMHRDIKPANVF  138 (267)
T ss_pred             HHHHHHHHHHHHHHhCCEecCCcChhhEE
Confidence            44578999999999999999999999975


No 301
>PRK01723 3-deoxy-D-manno-octulosonic-acid kinase; Reviewed
Probab=82.37  E-value=0.66  Score=41.35  Aligned_cols=28  Identities=14%  Similarity=0.040  Sum_probs=25.7

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+..|.+||.+.|+|+|.++.|||
T Consensus       147 ~~~~i~~~l~~lH~~GI~HrDlkp~NIL  174 (239)
T PRK01723        147 QWQAIGQLIARFHDAGVYHADLNAHNIL  174 (239)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCCchhEE
Confidence            4568999999999999999999999996


No 302
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase 4 (CDK4) and CDK6-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK4/6-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK4 and CDK6 partner with D-type cyclins to regulate the early G1 phase of the cell cycle. They are the first kinase activated by mitogenic signals to release cells from the G0 arrested state. CDK4 and CDK6 are both
Probab=82.32  E-value=0.66  Score=39.50  Aligned_cols=30  Identities=7%  Similarity=0.076  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|+|++.++.||+
T Consensus       110 ~~~~~~i~~al~~LH~~~i~h~~l~~~nil  139 (287)
T cd07838         110 KDLMRQLLRGVDFLHSHRIVHRDLKPQNIL  139 (287)
T ss_pred             HHHHHHHHHHHHHHHHCCeeeccCChhhEE
Confidence            445678999999999999999999999985


No 303
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase (CDK)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDKs are partly regulated by their subcellular localization, which defines substrate phosphorylation and the resulting specific function. CDK1, CDK2, CDK4, and CDK6 have well-defined functions in the cell cycle, such as the regulation of the 
Probab=82.26  E-value=0.64  Score=39.50  Aligned_cols=29  Identities=10%  Similarity=0.053  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       102 ~~~~~i~~~l~~LH~~~i~H~~l~~~ni~  130 (282)
T cd07829         102 SIMYQLLRGLAYCHSHRILHRDLKPQNIL  130 (282)
T ss_pred             HHHHHHHHHHHHHHHCCcccCCCChheEE
Confidence            34578999999999999999999999875


No 304
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal PBS2-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=82.20  E-value=0.61  Score=40.16  Aligned_cols=29  Identities=10%  Similarity=0.222  Sum_probs=25.0

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++ .|+|+|.++.||+
T Consensus       106 ~~~~~i~~~l~~LH~~~~i~H~dl~p~nil  135 (286)
T cd06622         106 RITYAVVKGLKFLKEEHNIIHRDVKPTNVL  135 (286)
T ss_pred             HHHHHHHHHHHHHHhcCCEeeCCCCHHHEE
Confidence            4457899999999964 8999999999986


No 305
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases. Protein Kinases (PKs), STE family, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The STE family is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases (STKs), protein tyrosine kinases (PTKs), RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). This family is composed of STKs, and some dual-specificity PKs that phosphorylate both threonine and tyrosine residues of target proteins. Most members are kinases involved in mitogen-activated protein kinase (MAPK) signaling cascades, acting as MAPK kinases (MAPKKs), MAPK kinase kinases (MAPKKKs), or MAPK kinase kinase kinases (MAP4Ks). The MAPK signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core 
Probab=82.09  E-value=0.75  Score=37.66  Aligned_cols=28  Identities=18%  Similarity=0.208  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|++||++.|.|+|.++.||+
T Consensus       103 i~~~i~~~l~~lh~~~i~h~dl~p~ni~  130 (253)
T cd05122         103 VCKELLKGLEYLHSNGIIHRDIKAANIL  130 (253)
T ss_pred             HHHHHHHHHHHhhcCCEecCCCCHHHEE
Confidence            4568999999999999999999999985


No 306
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase. Protein Tyrosine Kinase (PTK) family; Hematopoietic cell kinase (Hck); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Hck is a member of the Src subfamily of proteins, which are cytoplasmic (or non-receptor) tyr kinases. Src kinases contain an N-terminal SH4 domain with a myristoylation site, followed by SH3 and SH2 domains, a tyr kinase domain, and a regulatory C-terminal region containing a conserved tyr. They are activated by autophosphorylation at the tyr kinase domain, but are negatively regulated by phosphorylation at the C-terminal tyr by Csk (C-terminal Src Kinase). Src proteins are involved in signaling pa
Probab=82.05  E-value=0.63  Score=39.63  Aligned_cols=29  Identities=17%  Similarity=0.137  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...+|+.+|.+||+..|+|+|+++.||+
T Consensus       106 ~~~~~l~~aL~~lH~~~i~H~dl~p~ni~  134 (260)
T cd05073         106 DFSAQIAEGMAFIEQRNYIHRDLRAANIL  134 (260)
T ss_pred             HHHHHHHHHHHHHHhCCccccccCcceEE
Confidence            34468999999999999999999999976


No 307
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2. Protein Tyrosine Kinase (PTK) family; Ephrin Receptor (EphR) subfamily; EphA2 receptor; catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. EphRs comprise the largest subfamily of receptor tyr kinases (RTKs). In general, class EphA receptors bind GPI-anchored ephrin-A ligands. There are ten vertebrate EphA receptors (EphA1-10), which display promiscuous interactions with six ephrin-A ligands. EphRs contain an ephrin binding domain and two fibronectin repeats extracellularly, a transmembrane segment, and a cytoplasmic tyr kinase domain. Binding of the ephrin ligand to EphR requires cell-cell contact since both are anchored 
Probab=82.03  E-value=0.58  Score=39.80  Aligned_cols=30  Identities=20%  Similarity=0.189  Sum_probs=26.1

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.+++||+
T Consensus       110 ~~~~~~l~~al~~lH~~~i~H~dlkp~Nil  139 (268)
T cd05063         110 VGMLRGIAAGMKYLSDMNYVHRDLAARNIL  139 (268)
T ss_pred             HHHHHHHHHHHHHHHHCCeeccccchhhEE
Confidence            344567889999999999999999999986


No 308
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12. Serine/Threonine Kinases (STKs), Cyclin-Dependent protein Kinase 12 (CDK12) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDK12 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. CDK12 is also called Cdc2-related protein kinase 7 (CRK7) or Cdc2-related kinase arginine/serine-rich (CrkRS). It is a unique CDK that contains an arginine/serine-rich (RS) domain, which is predominantly found in splicing factors. CDK12 is widely
Probab=81.91  E-value=0.71  Score=39.99  Aligned_cols=31  Identities=10%  Similarity=0.057  Sum_probs=27.3

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+-..+|+.+|.+||+..|+|++.++.+|+
T Consensus       118 ~~~i~~qi~~aL~~LH~~~i~H~dl~p~nil  148 (302)
T cd07864         118 IKSFMKQLLEGLNYCHKKNFLHRDIKCSNIL  148 (302)
T ss_pred             HHHHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3455678999999999999999999999986


No 309
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase. Serine/Threonine Kinases (STKs), Microtubule-associated serine/threonine (MAST) kinase subfamily, MAST, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAST kinase subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAST kinases contain an N-terminal domain of unknown function, a central catalytic domain, and a C-terminal PDZ domain that mediates protein-protein interactions. There are four mammalian MAST kinases, named MAST1-MAST4. MAST1 is also referred to as syntrophin-associated STK (SAST), while MAST2 is also called MAST205. MAST kinases are cytoskeletal associated kinases of unknown function that a
Probab=81.90  E-value=0.7  Score=40.64  Aligned_cols=27  Identities=11%  Similarity=0.091  Sum_probs=24.5

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.||+
T Consensus       107 ~~~i~~~l~~lH~~~i~H~dl~p~NIl  133 (305)
T cd05609         107 FAETVLALEYLHNYGIVHRDLKPDNLL  133 (305)
T ss_pred             HHHHHHHHHHHHHCCccccCCchHHEE
Confidence            357889999999999999999999985


No 310
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4. Serine/threonine kinases (STKs), yeast Sps1/Ste20-related kinase 4 (YSK4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The YSK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. YSK4 is a putative MAPKKK, whose mammalian gene has been isolated. MAPKKKs (MKKKs or MAP3Ks) phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals.
Probab=81.78  E-value=0.73  Score=39.10  Aligned_cols=30  Identities=10%  Similarity=0.127  Sum_probs=26.4

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ....+|+.+|.+||+..|+|++.++.||+=
T Consensus       106 ~~~~qi~~~l~~lH~~~i~H~dl~p~nil~  135 (265)
T cd06631         106 KYTKQILDGVAYLHNNCVVHRDIKGNNVML  135 (265)
T ss_pred             HHHHHHHHHHHHHHhCCcccCCcCHHhEEE
Confidence            345789999999999999999999999873


No 311
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1. Serine/threonine kinases (STKs), thousand-and-one amino acids 1 (TAO1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO1 is sometimes referred to as prostate-derived sterile 20-like kinase 2 (PSK2). TAO1 activates the p38 MAPK through direct interaction with and activation of MEK3. TAO1 is highly expressed in the brain and may play a role in neuron
Probab=81.62  E-value=0.69  Score=41.13  Aligned_cols=28  Identities=18%  Similarity=0.191  Sum_probs=25.3

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|++.++.||+
T Consensus       130 i~~~i~~~l~~lH~~~i~H~dL~p~Nil  157 (317)
T cd06635         130 ITHGALQGLAYLHSHNMIHRDIKAGNIL  157 (317)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCcccEE
Confidence            3467999999999999999999999986


No 312
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins. Serine/threonine kinases (STKs), thousand-and-one amino acids (TAO) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. They activate the MAPKs, p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activating the respective MAP/ERK kinases (MEKs, also known as MKKs or MAPKKs), MEK3/MEK6 and MKK4/MKK7. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Vertebrates contain three TAO subfamily
Probab=81.57  E-value=0.68  Score=40.78  Aligned_cols=29  Identities=14%  Similarity=0.106  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       119 ~~~~ql~~~L~~LH~~~i~H~dl~p~nIl  147 (307)
T cd06607         119 AICHGALQGLAYLHSHERIHRDIKAGNIL  147 (307)
T ss_pred             HHHHHHHHHHHHHHHCCceecCCCcccEE
Confidence            34578999999999999999999999986


No 313
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 4, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK4 belongs to group II. Group II PAKs contain a PBD (p21-binding domain) and a C-terminal catalytic domain, but do not harbor an AID (autoinhibitory domain) or SH3 binding sites. PAK4 regulates cell mo
Probab=81.54  E-value=0.75  Score=40.62  Aligned_cols=29  Identities=17%  Similarity=0.207  Sum_probs=26.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|++||++.|+|+|.+++||+
T Consensus       120 ~~~~ql~~~l~~lH~~givH~dl~p~Nil  148 (292)
T cd06657         120 AVCLAVLKALSVLHAQGVIHRDIKSDSIL  148 (292)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHEE
Confidence            45578999999999999999999999986


No 314
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Phototropin-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The phototropin-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Included in this subfamily are plant phototropins and predominantly uncharacterized fungal STKs whose catalytic domains resemble the phototropin kinase domain. One protein from Neurospora crassa is called nrc-2. Phototropins are blue-light receptors that control responses such as phototropism, stromatal opening, and chloroplast movement in order to optimize the photosynthetic efficiency of plants. They are light-activated STKs that contain an N-termin
Probab=81.46  E-value=0.69  Score=40.70  Aligned_cols=27  Identities=11%  Similarity=0.078  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||+..|+|+|.++.||+
T Consensus       109 ~~qi~~~l~~lH~~~i~H~dlkp~Nil  135 (316)
T cd05574         109 AAEVLLALEYLHLLGIVYRDLKPENIL  135 (316)
T ss_pred             HHHHHHHHHHHHHCCeeccCCChHHeE
Confidence            458999999999999999999999986


No 315
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3-like subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This subfamily is composed of MST3, MST4, STK25, Schizosaccharomyces pombe Nak1 and Sid1, Saccharomyces cerevisiae sporulation-specific protein 1 (SPS1), and related proteins. Nak1 is required by fission yeast for polarizing the tips of actin cytoskeleton and is involved in cell growth, cell separation, cell morphology and cell-cycle progression. Sid1 is a component in the septation initiation network (SIN)
Probab=81.32  E-value=0.81  Score=39.14  Aligned_cols=30  Identities=17%  Similarity=0.079  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|++.++.+|+
T Consensus       101 ~~~~~ql~~~l~~lh~~~i~h~dl~p~ni~  130 (274)
T cd06609         101 AFILREVLLGLEYLHEEGKIHRDIKAANIL  130 (274)
T ss_pred             HHHHHHHHHHHHHHHhCCcccCCCCHHHEE
Confidence            445578999999999999999999999986


No 316
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO2 is present in archaea and eukaryotes. It contains an N-terminal winged helix (wHTH) domain and a C-terminal RIO kinase catalytic domain. The wHTH domain is primarily seen in DNA-binding proteins, although some wHTH dom
Probab=81.11  E-value=0.77  Score=38.62  Aligned_cols=31  Identities=6%  Similarity=-0.018  Sum_probs=27.0

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...-..+|+..|.+||...|+|+|.+++||+
T Consensus       127 ~~~~~~~i~~~l~~lh~~gi~H~Dl~p~Nil  157 (198)
T cd05144         127 PEEVLDEILEEIVKAYKHGIIHGDLSEFNIL  157 (198)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCcCCCCcccEE
Confidence            3445578999999999999999999999985


No 317
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, fungal Bck1-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Members of this group include the MAPKKKs Saccharomyces cerevisiae Bck1 and Schizosaccharomyces pombe Mkh1, and related proteins. MAPKKKs phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. Budding yeast Bck1 is part of the cell inte
Probab=81.10  E-value=0.79  Score=39.08  Aligned_cols=27  Identities=11%  Similarity=0.196  Sum_probs=24.9

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.+|+
T Consensus       114 ~~qi~~~l~~lH~~~i~H~dl~~~nil  140 (272)
T cd06629         114 TEQVLEGLAYLHSKGILHRDLKADNLL  140 (272)
T ss_pred             HHHHHHHHHHHhhCCeeecCCChhhEE
Confidence            468999999999999999999999986


No 318
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 3, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK3 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=80.92  E-value=0.82  Score=40.28  Aligned_cols=30  Identities=10%  Similarity=0.107  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       118 ~~~~~~l~~~L~~LH~~~i~H~dL~p~Nil  147 (297)
T cd06656         118 AAVCRECLQALDFLHSNQVIHRDIKSDNIL  147 (297)
T ss_pred             HHHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            345578999999999999999999999986


No 319
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=80.89  E-value=0.85  Score=52.62  Aligned_cols=6  Identities=17%  Similarity=0.373  Sum_probs=3.0

Q ss_pred             ccccCC
Q 024658           48 VCQSLT   53 (264)
Q Consensus        48 ~C~~~p   53 (264)
                      .|+.|.
T Consensus        95 ~~~~~~  100 (2849)
T PTZ00415         95 TCPFHK  100 (2849)
T ss_pred             cCcccc
Confidence            455544


No 320
>KOG0593 consensus Predicted protein kinase KKIAMRE [General function prediction only]
Probab=80.70  E-value=0.8  Score=44.97  Aligned_cols=29  Identities=3%  Similarity=0.000  Sum_probs=26.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..-+|+.++.+.|+..|||||+|+-|||
T Consensus       105 ~~l~Q~l~ai~~cHk~n~IHRDIKPENIL  133 (396)
T KOG0593|consen  105 KYLYQLLKAIHFCHKNNCIHRDIKPENIL  133 (396)
T ss_pred             HHHHHHHHHhhhhhhcCeecccCChhheE
Confidence            45678999999999999999999999998


No 321
>KOG0583 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=80.51  E-value=0.8  Score=43.92  Aligned_cols=26  Identities=12%  Similarity=0.139  Sum_probs=25.0

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .|||.++.|+|+..|.|||.|+-|||
T Consensus       127 ~Qlisav~y~H~~gi~HRDLK~ENil  152 (370)
T KOG0583|consen  127 RQLISAVAYCHSRGIVHRDLKPENIL  152 (370)
T ss_pred             HHHHHHHHHHHhCCEeeCCCCHHHEE
Confidence            89999999999999999999999986


No 322
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, MSK1, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, which trigger phosphorylation in the activation loop (A-loop) of the CTD of MSK. The active CTD phosphorylates the hydroph
Probab=80.44  E-value=0.83  Score=39.56  Aligned_cols=27  Identities=15%  Similarity=0.059  Sum_probs=24.7

Q ss_pred             HHHHHHhhhhccccccccCcchhhhHh
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .+|+.+|.+||+..|+|+|.++.|||-
T Consensus       112 ~qi~~al~~lH~~~i~H~dl~p~nil~  138 (290)
T cd05613         112 GEIVLALEHLHKLGIIYRDIKLENILL  138 (290)
T ss_pred             HHHHHHHHHHHhCCeeccCCCHHHeEE
Confidence            479999999999999999999999863


No 323
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase. Serine/threonine kinases (STKs), oxidative stress response kinase (OSR1) and Ste20-related proline alanine-rich kinase (SPAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The OSR1 and SPAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. SPAK is also referred to as STK39 or PASK (proline-alanine-rich STE20-related kinase). OSR1 and SPAK regulate the activity of cation-chloride cotransporters through direct interaction and phosphorylation. They are also implicated in cytoskeletal rearrangement, cell differentiation, transformation and proliferation. OSR1 
Probab=80.34  E-value=0.86  Score=38.25  Aligned_cols=29  Identities=14%  Similarity=0.134  Sum_probs=25.9

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.+|+
T Consensus       106 ~~~~ql~~al~~lh~~~i~h~~l~p~ni~  134 (267)
T cd06610         106 TVLKEVLKGLEYLHSNGQIHRDIKAGNIL  134 (267)
T ss_pred             HHHHHHHHHHHHHHhCCeecCCCCHHhEE
Confidence            34578999999999999999999999986


No 324
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=80.32  E-value=0.8  Score=50.14  Aligned_cols=14  Identities=21%  Similarity=0.327  Sum_probs=7.2

Q ss_pred             cccccccccccCCC
Q 024658           41 LRCLLCHVCQSLTP   54 (264)
Q Consensus        41 ~RvpLC~~C~~~p~   54 (264)
                      .|.+|-+.|-.++.
T Consensus      1358 v~R~~~Dlct~~~D 1371 (1516)
T KOG1832|consen 1358 VDRCLLDLCTEPTD 1371 (1516)
T ss_pred             cccchhhhhcCCcc
Confidence            34444456665553


No 325
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), Cyclin-dependent protein kinase like (CDKL) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The CDKL subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. CDKs belong to a large family of STKs that are regulated by their cognate cyclins. Together, they are involved in the control of cell-cycle progression, transcription, and neuronal function. This subfamily is composed of CDKL1-5 and similar proteins. Some CDKLs, like CDKL1 and CDKL3, may be implicated in transformation and others, like CDKL3 and CDKL5, are associated with mental retardation when impaired. CDKL2 plays a role in learning 
Probab=80.08  E-value=0.91  Score=38.81  Aligned_cols=29  Identities=7%  Similarity=0.056  Sum_probs=26.1

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|++.++.+|+
T Consensus       104 ~~~~~i~~~l~~LH~~~i~H~dl~~~ni~  132 (288)
T cd07833         104 SYIWQLLQAIAYCHSHNIIHRDIKPENIL  132 (288)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            34568999999999999999999999987


No 326
>KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms]
Probab=79.93  E-value=0.8  Score=45.77  Aligned_cols=29  Identities=14%  Similarity=0.116  Sum_probs=26.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++..||-.+|+.||.+.|||||.|+-|||
T Consensus       113 ~Fm~QLA~alq~L~~~~IiHRDLKPQNiL  141 (429)
T KOG0595|consen  113 HFMQQLASALQFLHENNIIHRDLKPQNIL  141 (429)
T ss_pred             HHHHHHHHHHHHHHHCCeeeccCCcceEE
Confidence            44578999999999999999999999998


No 327
>TIGR03724 arch_bud32 Kae1-associated kinase Bud32. Members of this protein family are the Bud32 protein associated with Kae1 (kinase-associated endopeptidase 1) in the Archaea. In many Archaeal genomes, Kae1 and Bud32 are fused. The complex is homologous to the Kae1 and Bud32 subunits of the eukaryotic KEOPS complex, an apparently ancient protein kinase-containing molecular machine.
Probab=79.78  E-value=0.87  Score=37.71  Aligned_cols=29  Identities=10%  Similarity=0.011  Sum_probs=26.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-..+|...|.+||++.|+|+|.++.||+
T Consensus        94 ~~~~~i~~~l~~lH~~gi~H~Dl~~~Nil  122 (199)
T TIGR03724        94 ELLREIGRLVGKLHKAGIVHGDLTTSNII  122 (199)
T ss_pred             HHHHHHHHHHHHHHHCCeecCCCCcceEE
Confidence            44678999999999999999999999985


No 328
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase. Serine/threonine kinases (STKs), mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MAPKKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MAPKKKs (MKKKs or MAP3Ks) are also called MAP/ERK kinase kinases (MEKKs) in some cases. They phosphorylate and activate MAPK kinases (MAPKKs or MKKs or MAP2Ks), which in turn phosphorylate and activate MAPKs during signaling cascades that are important in mediating cellular responses to extracellular signals. This subfamily is composed of the Apoptosis Signal-regulating Kinases ASK1 (or MAPKK
Probab=79.69  E-value=0.98  Score=37.15  Aligned_cols=30  Identities=17%  Similarity=0.174  Sum_probs=26.7

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|++.++.+|+
T Consensus       104 ~~~~~~l~~~l~~lh~~~~~h~dl~p~ni~  133 (260)
T cd06606         104 RKYTRQILEGLAYLHSNGIVHRDIKGANIL  133 (260)
T ss_pred             HHHHHHHHHHHHHHHHCCccccCCCHHHEE
Confidence            345678999999999999999999999986


No 329
>KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only]
Probab=79.58  E-value=0.85  Score=45.21  Aligned_cols=34  Identities=9%  Similarity=0.181  Sum_probs=28.4

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +++.---.-|++.+|++||..-|+|||.|.+|+|
T Consensus       176 ~~evK~L~~QlL~glk~lH~~wilHRDLK~SNLL  209 (419)
T KOG0663|consen  176 PGEVKTLMLQLLRGLKHLHDNWILHRDLKTSNLL  209 (419)
T ss_pred             hHHHHHHHHHHHHHHHHHhhceeEecccchhhee
Confidence            3344444568999999999999999999999987


No 330
>smart00090 RIO RIO-like kinase.
Probab=79.46  E-value=0.95  Score=40.41  Aligned_cols=30  Identities=13%  Similarity=0.144  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhcccc-ccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQT-MTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~-i~~~d~~~a~i~  252 (264)
                      .....+|+..|.+||.+. |+|+|.++.||+
T Consensus       151 ~~i~~qi~~~l~~LH~~g~iiH~Dikp~NIl  181 (237)
T smart00090      151 FELYDDILEEMRKLYKEGELVHGDLSEYNIL  181 (237)
T ss_pred             HHHHHHHHHHHHHHHhcCCEEeCCCChhhEE
Confidence            345678999999999999 999999999984


No 331
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase. Serine/threonine kinases (STKs), STK10 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK10 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Other names for STK10 include lymphocyte-oriented kinase (LOK) and Xenopus polo-like kinase kinase 1 (xPlkk1). STK10 is highly expressed in lymphocytes and is responsible in regulating leukocyte function associated antigen (LFA-1)-mediated lymphocyte adhesion. It plays a role in regulating the CD28 responsive element in T cells, and may also function as a regulator of polo-like kinase 1 (Plk1), a protein which is overexpressed in multiple tumor types.
Probab=79.30  E-value=0.87  Score=39.58  Aligned_cols=30  Identities=10%  Similarity=0.135  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       113 ~~~~~ql~~~l~~lH~~~i~H~dlkp~Nil  142 (292)
T cd06644         113 QVICRQMLEALQYLHSMKIIHRDLKAGNVL  142 (292)
T ss_pred             HHHHHHHHHHHHHHhcCCeeecCCCcceEE
Confidence            344578899999999999999999999986


No 332
>PRK12274 serine/threonine protein kinase; Provisional
Probab=79.29  E-value=0.87  Score=41.64  Aligned_cols=28  Identities=14%  Similarity=-0.038  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCc-chhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGD-AAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~-~~a~i~  252 (264)
                      ...+|+..|++||.+.|+|+|. +++|||
T Consensus        96 ~~~qi~~~L~~lH~~GIvHrDL~kp~NIL  124 (218)
T PRK12274         96 YFRAARRLLQQLHRCGVAHNDLAKEANWL  124 (218)
T ss_pred             HHHHHHHHHHHHHHCcCccCCCCCcceEE
Confidence            4578899999999999999999 788887


No 333
>PLN03224 probable serine/threonine protein kinase; Provisional
Probab=79.11  E-value=0.93  Score=45.58  Aligned_cols=28  Identities=11%  Similarity=0.191  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|||.|++|||
T Consensus       314 i~~ql~~aL~~lH~~~ivHrDLKp~NIL  341 (507)
T PLN03224        314 VMRQVLTGLRKLHRIGIVHRDIKPENLL  341 (507)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCchHhEE
Confidence            3467888999999999999999999996


No 334
>KOG0584 consensus Serine/threonine protein kinase [General function prediction only]
Probab=79.05  E-value=0.9  Score=47.34  Aligned_cols=30  Identities=20%  Similarity=0.157  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .+-.++|+++|+|||+++  |||||.|=-|||
T Consensus       146 k~W~RQILkGL~yLHs~~PPIIHRDLKCDNIF  177 (632)
T KOG0584|consen  146 KSWCRQILKGLVYLHSQDPPIIHRDLKCDNIF  177 (632)
T ss_pred             HHHHHHHHHHhhhhhcCCCCccccccccceEE
Confidence            467899999999999986  999999998885


No 335
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2. Serine/threonine kinases (STKs), p21-activated kinase (PAK) 2, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs from higher eukaryotes are classified into two groups (I and II), according to their biochemical and structural features. PAK2 belongs to group I. Group I PAKs contain a PBD (p21-binding domain) overlapping with an AID (autoinhibitory domain), a C-terminal catalytic domain, SH3 binding sites and a non-classical SH3 binding 
Probab=79.05  E-value=1  Score=39.69  Aligned_cols=30  Identities=7%  Similarity=0.091  Sum_probs=26.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|+|.++.||+
T Consensus       118 ~~i~~~l~~al~~LH~~~i~H~dL~p~Nil  147 (296)
T cd06655         118 AAVCRECLQALEFLHANQVIHRDIKSDNVL  147 (296)
T ss_pred             HHHHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            344568999999999999999999999986


No 336
>PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated
Probab=79.03  E-value=0.99  Score=44.57  Aligned_cols=28  Identities=4%  Similarity=-0.016  Sum_probs=25.6

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|...|.+||+..|+|||.+++|||
T Consensus       433 ~~~~i~~~L~~lH~~giiHrDlkp~NIL  460 (535)
T PRK09605        433 LVRKVGEIVAKLHKAGIVHGDLTTSNFI  460 (535)
T ss_pred             HHHHHHHHHHHHHhCCCccCCCChHHEE
Confidence            3478899999999999999999999997


No 337
>cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2. Serine/threonine kinases (STKs), thousand-and-one amino acids 2 (TAO2) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. Human TAO2 is also known as prostate-derived Ste20-like kinase (PSK) and was identified in a screen for overexpressed RNAs in prostate cancer. TAO2 activates both p38 and c-Jun N-terminal kinase (JNK), by phosphorylating and activatin
Probab=78.79  E-value=1  Score=39.84  Aligned_cols=28  Identities=18%  Similarity=0.207  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+..|+|+|.++.|||
T Consensus       120 ~~~~l~~~l~~LH~~~i~H~dl~p~nil  147 (308)
T cd06634         120 VTHGALQGLAYLHSHNMIHRDVKAGNIL  147 (308)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCHHhEE
Confidence            3467889999999999999999999986


No 338
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1. Protein kinases (PKs), MAP/ERK kinase (MEK) 1 subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 is a dual-specificity PK that phosphorylates and activates the downst
Probab=78.67  E-value=1  Score=40.74  Aligned_cols=30  Identities=20%  Similarity=0.209  Sum_probs=25.3

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~~  253 (264)
                      ....+|+.+|.+||++ .|+|+|.++.|||-
T Consensus       107 ~~~~~l~~~l~~lH~~~~ivH~dlkp~Nili  137 (333)
T cd06650         107 KVSIAVIKGLTYLREKHKIMHRDVKPSNILV  137 (333)
T ss_pred             HHHHHHHHHHHHHHhcCCEEecCCChhhEEE
Confidence            3456899999999975 69999999999873


No 339
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase. Serine/Threonine Kinases (STKs), p38 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The p38 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. p38 kinases are mitogen-activated protein kinases (MAPKs), serving as important mediators of cellular responses to extracellular signals. They function in the regulation of the cell cycle, cell development, cell differentiation, senescence, tumorigenesis, apoptosis, pain development and pain progression, and immune responses. p38 kinases are activated by the MAPK kinases MKK3 and MKK6, which in turn are activated by upstream MAPK kinase kinases including TAK1, ASK1, and MLK
Probab=78.65  E-value=1.1  Score=40.49  Aligned_cols=30  Identities=10%  Similarity=0.101  Sum_probs=26.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|++.++.||+
T Consensus       121 ~~~~~ql~~aL~~LH~~gi~H~dlkp~Nil  150 (343)
T cd07851         121 QFLVYQILRGLKYIHSAGIIHRDLKPSNIA  150 (343)
T ss_pred             HHHHHHHHHHHHHHHHCCeecCCCCHHHeE
Confidence            345578999999999999999999999985


No 340
>cd08222 STKc_Nek11 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 11. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 11 (Nek11) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek11 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek11 is involved, through direct phosphorylation, in regulating the degradation of Cdc25A (Cell Division Cycle 25 homolog A), which plays a role in cell cycle progression and in activating cyclin dependent kinases. Nek11 is activated by CHK1 (CHeckpoint Kinase 1) and may be involved in the G2/M check
Probab=78.60  E-value=1.1  Score=37.93  Aligned_cols=30  Identities=7%  Similarity=0.065  Sum_probs=26.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|+|++.++.+|+
T Consensus       109 ~~~~~~l~~~l~~lH~~~i~h~~l~~~nil  138 (260)
T cd08222         109 CEWFIQLLLGVHYMHQRRILHRDLKAKNIF  138 (260)
T ss_pred             HHHHHHHHHHHHHHHHcCccccCCChhheE
Confidence            344568999999999999999999999985


No 341
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3. Serine/threonine kinases (STKs), thousand-and-one amino acids 3 (TAO3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The TAO subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. TAO proteins possess mitogen-activated protein kinase (MAPK) kinase kinase (MAPKKK or MAP3K or MKKK) activity. MAPK signaling cascades are important in mediating cellular responses to extracellular signals. TAO3 is also known as JIK (JNK inhibitory kinase) or KFC (kinase from chicken). It specifically activates c-Jun N-terminal kinase (JNK), presumably by phosphorylating and activating MKK4/MKK7. In Saccharomyces cerevisiae, TAO3 is a co
Probab=78.46  E-value=1  Score=40.04  Aligned_cols=28  Identities=18%  Similarity=0.191  Sum_probs=25.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.+|+
T Consensus       126 ~~~qi~~al~~LH~~gi~H~dl~p~nil  153 (313)
T cd06633         126 ITHGALQGLAYLHSHNMIHRDIKAGNIL  153 (313)
T ss_pred             HHHHHHHHHHHHHHCCeecCCCChhhEE
Confidence            4578999999999999999999999987


No 342
>KOG0669 consensus Cyclin T-dependent kinase CDK9 [Cell cycle control, cell division, chromosome partitioning]
Probab=78.41  E-value=0.69  Score=44.71  Aligned_cols=31  Identities=19%  Similarity=0.350  Sum_probs=26.5

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH----hhhhc
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT----GICRL  257 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l  257 (264)
                      ..++++|.+||.-+|+|||.|+||+|    ||=||
T Consensus       131 k~Lm~GL~~iHr~kilHRDmKaaNvLIt~dgilkl  165 (376)
T KOG0669|consen  131 KGLMNGLYYIHRNKILHRDMKAANVLITKDGILKL  165 (376)
T ss_pred             HHHHHHHHHHHHhhHHhhcccHhhEEEcCCceEEe
Confidence            45788999999999999999999987    55444


No 343
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2,  and similar domains. Serine/Threonine Kinases (STKs), Chlamydomonas reinhardtii Never In Mitosis gene A (NIMA)-related kinase 1 (CNK2)-like subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Chlamydomonas reinhardtii CNK2-like subfamily belongs to the (NIMA)-related kinase (Nek) family. The Nek family includes seven different Chlamydomonas Neks (CNKs 1-6 and Fa2). This subfamily includes CNK1, and -2.  The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase.  Chlamydomonas reinhardtii CNK2 has both cilliary and cell cycle functions. It influences flagellar length through promoting flagellar disassembly, an
Probab=78.34  E-value=1.1  Score=37.45  Aligned_cols=29  Identities=17%  Similarity=0.222  Sum_probs=25.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+..|+|++.++.+|+
T Consensus       107 ~~~~~l~~al~~lh~~~i~h~~l~~~ni~  135 (256)
T cd08530         107 RIFIQLLRGLQALHEQKILHRDLKSANIL  135 (256)
T ss_pred             HHHHHHHHHHHHHhhCCcccCCCCcceEE
Confidence            34467999999999999999999999975


No 344
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase. Serine/Threonine Kinases (STKs), Mitogen and stress-activated kinase (MSK) subfamily, N-terminal catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MSK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MSKs contain an N-terminal kinase domain (NTD) from the AGC family and a C-terminal kinase domain (CTD) from the CAMK family, similar to 90 kDa ribosomal protein S6 kinases (RSKs). MSKs are activated by two major signaling cascades, the Ras-MAPK and p38 stress kinase pathways, in response to various stimuli such as growth factors, hormones, neurotransmitters, cellular stress, and pro-inflammatory cytokines
Probab=78.17  E-value=1.1  Score=38.75  Aligned_cols=27  Identities=15%  Similarity=0.102  Sum_probs=24.6

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.+||++.|+|+|.++.||+
T Consensus       111 ~~ql~~~l~~lH~~~~~H~dl~p~nil  137 (288)
T cd05583         111 IAEIVLALDHLHQLGIIYRDIKLENIL  137 (288)
T ss_pred             HHHHHHHHHHHHHCCeeccCCCHHHeE
Confidence            358999999999999999999999985


No 345
>PF07714 Pkinase_Tyr:  Protein tyrosine kinase Protein kinase; unclassified specificity. Tyrosine kinase, catalytic domain;  InterPro: IPR001245 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. Tyrosine-protein kinases can transfer a phosphate group from ATP to a tyrosine residue in a protein. These enzymes can be divided into two main groups []:   Receptor tyrosine kinases (RTK), which are transmembrane proteins involved in signal transduction; they play key roles in growth, differentiation, metabolism, adhesion, motility, death and oncogenesis []. RTKs are composed of 3 domains: an extracellular domain (binds ligand), a transmembrane (TM) domain, and an intracellular catalytic domain (phosphorylates substrate). The TM domain plays an important role in the dimerisation process necessary for signal transduction [].      Cytoplasmic / non-receptor tyrosine kinases, which act as regulatory proteins, playing key roles in cell differentiation, motility, proliferation, and survival. For example, the Src-family of protein-tyrosine kinases [].  ; GO: 0004672 protein kinase activity, 0006468 protein phosphorylation; PDB: 2HYY_C 1OPL_A 2V7A_A 2G2H_B 2G1T_A 3PYY_A 3CS9_D 2HZI_A 2E2B_A 2HIW_A ....
Probab=78.08  E-value=1.1  Score=38.70  Aligned_cols=30  Identities=17%  Similarity=0.181  Sum_probs=25.5

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+-..+|+.+|.+||++.|+|++..+.+||
T Consensus       106 ~~i~~~i~~~l~~Lh~~~iiH~~l~~~nil  135 (259)
T PF07714_consen  106 LSIAIQIAEALSYLHSNNIIHGNLSPSNIL  135 (259)
T ss_dssp             HHHHHHHHHHHHHHHHTTEEEST-SGGGEE
T ss_pred             cccccccccccccccccccccccccccccc
Confidence            344578999999999999999999999886


No 346
>KOG0603 consensus Ribosomal protein S6 kinase [Signal transduction mechanisms]
Probab=78.02  E-value=0.44  Score=49.48  Aligned_cols=28  Identities=14%  Similarity=0.170  Sum_probs=26.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhHh
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..+|+..+.+||.|.|++||.++.|||=
T Consensus       421 ~~~lv~Av~~LH~~gvvhRDLkp~NIL~  448 (612)
T KOG0603|consen  421 AAELVSAVDYLHEQGVVHRDLKPGNILL  448 (612)
T ss_pred             HHHHHHHHHHHHhcCeeecCCChhheee
Confidence            3789999999999999999999999983


No 347
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK or MAP2K), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK or MAP3K). MAPKKs are dual-specificity
Probab=78.01  E-value=1.3  Score=37.34  Aligned_cols=28  Identities=14%  Similarity=0.229  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+ ..|+|++.++.||+
T Consensus       105 ~~~~l~~~l~~lH~~~~i~H~dl~~~ni~  133 (265)
T cd06605         105 IAVAVLKGLTYLHEKHKIIHRDVKPSNIL  133 (265)
T ss_pred             HHHHHHHHHHHHcCCCCeecCCCCHHHEE
Confidence            34688999999999 99999999999985


No 348
>PRK14879 serine/threonine protein kinase; Provisional
Probab=78.01  E-value=1.1  Score=37.34  Aligned_cols=28  Identities=11%  Similarity=0.036  Sum_probs=24.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|...|.+||++.|+|+|.+++|||
T Consensus       100 i~~~i~~~l~~lH~~~i~H~Dl~p~Nil  127 (211)
T PRK14879        100 LSREIGRLVGKLHSAGIIHGDLTTSNMI  127 (211)
T ss_pred             HHHHHHHHHHHHHhCCcccCCCCcccEE
Confidence            3467888999999999999999999985


No 349
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase (Nek) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The Nek family is composed of 11 different mammalian members (Nek1-11) with similarity to the catalytic domain of Aspergillus nidulans NIMA kinase, the founding member of the Nek family which was identified in a screen for cell cycle mutants that were prevented from entering mitosis. Neks contain a conserved N-terminal catalytic domain and a more divergent C-terminal regulatory region of various sizes and structures. They 
Probab=77.83  E-value=1.2  Score=36.92  Aligned_cols=30  Identities=10%  Similarity=0.107  Sum_probs=26.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||++.|+|++.++.+|+
T Consensus       106 ~~i~~~i~~~l~~lh~~~~~H~dl~~~nil  135 (258)
T cd08215         106 LDWFVQLCLALKYLHSRKILHRDIKPQNIF  135 (258)
T ss_pred             HHHHHHHHHHHHHHHhCCEecccCChHHeE
Confidence            345678999999999999999999999976


No 350
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 4 (MST4) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST4 is sometimes referred to as MASK (MST3 and SOK1-related kinase). It plays a role in mitogen-activated protein kinase (MAPK) signaling during cytoskeletal rearrangement, morphogenesis, and apoptosis. It influences cell growth and transformation by modulating the extracellular signal-regulated kinase (ERK) pathway. MST4 may also play a role in tumor formation and progression. It localizes in the Golgi apparatus by inter
Probab=77.82  E-value=1.2  Score=38.30  Aligned_cols=30  Identities=17%  Similarity=0.168  Sum_probs=26.9

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||...|+|++.++.||+
T Consensus       104 ~~~~~~l~~~l~~lh~~~ivH~dl~p~Nil  133 (277)
T cd06640         104 ATMLKEILKGLDYLHSEKKIHRDIKAANVL  133 (277)
T ss_pred             HHHHHHHHHHHHHHHhCCccCcCCChhhEE
Confidence            355678999999999999999999999987


No 351
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1. Serine/threonine kinases (STKs), STK25 subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The STK25 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. STK25 is also called Ste20/oxidant stress response kinase 1 (SOK1) or yeast Sps1/Ste20-related kinase 1 (YSK1). STK25 is localized in the Golgi apparatus through its interaction with the Golgi matrix protein GM130. It may play a role in the regulation of cell migration and polarization. STK25 binds and phosphorylates CCM3 (cerebral cavernous malformation 3), also called PCD10 (programmed cell death 10), and may play a role in apoptosis. Human STK25 
Probab=77.73  E-value=1.1  Score=38.41  Aligned_cols=29  Identities=17%  Similarity=0.157  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||++.|+|++.++.||+
T Consensus       105 ~~~~~i~~~l~~lH~~~ivH~dl~p~ni~  133 (277)
T cd06642         105 TILREILKGLDYLHSERKIHRDIKAANVL  133 (277)
T ss_pred             HHHHHHHHHHHHHhcCCeeccCCChheEE
Confidence            34478999999999999999999999985


No 352
>KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=77.72  E-value=1.5  Score=41.73  Aligned_cols=32  Identities=3%  Similarity=-0.111  Sum_probs=27.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHhhh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITGIC  255 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~ic  255 (264)
                      --..++.+.|.|.|.+.|||||+|++|+|==|
T Consensus       128 ~Yi~q~A~Al~y~h~k~VIhRdiKpenlLlg~  159 (281)
T KOG0580|consen  128 TYIKQLANALLYCHLKRVIHRDIKPENLLLGS  159 (281)
T ss_pred             HHHHHHHHHHHHhccCCcccCCCCHHHhccCC
Confidence            34578889999999999999999999998544


No 353
>PRK13184 pknD serine/threonine-protein kinase; Reviewed
Probab=77.65  E-value=0.98  Score=48.94  Aligned_cols=28  Identities=7%  Similarity=0.043  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|||.|+.|||
T Consensus       118 I~~QIa~AL~yLHs~GIIHRDLKPeNIL  145 (932)
T PRK13184        118 IFHKICATIEYVHSKGVLHRDLKPDNIL  145 (932)
T ss_pred             HHHHHHHHHHHHHHCCccccCCchheEE
Confidence            3468999999999999999999999996


No 354
>cd05119 RIO RIO kinase family, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases present in archaea, bacteria and eukaryotes. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. RIO kinases contain a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. Most organisms contain at least two RIO kinases, RIO1 and RIO2. A third protein, RIO3, is present in multicellular eukaryotes. In yeast, RIO1 and RIO2 are essential for survival. They funct
Probab=77.63  E-value=1.3  Score=36.25  Aligned_cols=33  Identities=12%  Similarity=0.070  Sum_probs=27.9

Q ss_pred             CCCcchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          220 GQSVSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       220 ~~~~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .+......+|+..|..||. ..|+|+|.++.||+
T Consensus       114 ~~~~~~~~~~~~~l~~lh~~~~ivH~Dl~p~Nil  147 (187)
T cd05119         114 EDPEELYDQILELMRKLYREAGLVHGDLSEYNIL  147 (187)
T ss_pred             ccHHHHHHHHHHHHHHHhhccCcCcCCCChhhEE
Confidence            3444556789999999999 99999999999985


No 355
>KOG0576 consensus Mitogen-activated protein kinase kinase kinase kinase (MAP4K), germinal center kinase family [Signal transduction mechanisms]
Probab=77.42  E-value=0.81  Score=48.57  Aligned_cols=26  Identities=19%  Similarity=0.183  Sum_probs=23.8

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +..+.||+|||++.-+|||+|+||||
T Consensus       119 Retl~gl~ylhs~gk~hRdiKGanil  144 (829)
T KOG0576|consen  119 RETLQGLKYLHSQGKIHRDIKGANIL  144 (829)
T ss_pred             hhhhccchhhhcCCccccccccccee
Confidence            45678999999999999999999997


No 356
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4. Protein kinases (PKs), MAP kinase kinase 4 (MKK4) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK4 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK4 is a dual-specificity PK that phosphorylates and activates
Probab=77.38  E-value=1.1  Score=38.58  Aligned_cols=29  Identities=14%  Similarity=0.206  Sum_probs=24.5

Q ss_pred             chhHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ...-+|+.+|++||.+ .|+|+|.++.||+
T Consensus       111 ~i~~~i~~~l~~lh~~~~i~H~dlkp~Nil  140 (288)
T cd06616         111 KIAVATVKALNYLKEELKIIHRDVKPSNIL  140 (288)
T ss_pred             HHHHHHHHHHHHHhhcCCeeccCCCHHHEE
Confidence            3446788999999964 8999999999986


No 357
>KOG0984 consensus Mitogen-activated protein kinase (MAPK) kinase MKK3/MKK6 [Signal transduction mechanisms]
Probab=77.18  E-value=0.79  Score=43.16  Aligned_cols=26  Identities=12%  Similarity=0.258  Sum_probs=23.1

Q ss_pred             HHHHHHhhhhccc-cccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      --||..|.+||.| .|||||.|++|||
T Consensus       155 ~Svv~al~~L~~kL~vIHRDvKPsNiL  181 (282)
T KOG0984|consen  155 VSVVHALEFLHSKLSVIHRDVKPSNIL  181 (282)
T ss_pred             HHHHHHHHHHHHHhhhhhccCCcceEE
Confidence            3588999999987 6999999999996


No 358
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=77.12  E-value=1.5  Score=48.07  Aligned_cols=6  Identities=33%  Similarity=0.274  Sum_probs=2.3

Q ss_pred             cCCCCC
Q 024658           97 ISGHDE  102 (264)
Q Consensus        97 ~~~~d~  102 (264)
                      +.++||
T Consensus      1404 ~dd~De 1409 (1516)
T KOG1832|consen 1404 DDDSDE 1409 (1516)
T ss_pred             ccccCc
Confidence            333433


No 359
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, Plant MAPKKs and similar proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of
Probab=77.12  E-value=1.3  Score=37.05  Aligned_cols=29  Identities=10%  Similarity=0.147  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+ +.|+|++.++.+|+
T Consensus       103 ~~~~~l~~~l~~lh~~~~~~H~~l~~~ni~  132 (264)
T cd06623         103 YIARQILKGLDYLHTKRHIIHRDIKPSNLL  132 (264)
T ss_pred             HHHHHHHHHHHHHhccCCCccCCCCHHHEE
Confidence            345689999999999 99999999999986


No 360
>KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only]
Probab=76.97  E-value=1.2  Score=46.17  Aligned_cols=29  Identities=14%  Similarity=0.066  Sum_probs=27.0

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+++|+.+|..||...|||.|.|+.|||
T Consensus       293 ~~~~Qil~~L~~L~~l~IIHcDLKPENIL  321 (586)
T KOG0667|consen  293 KFAQQILTALLFLHELGIIHCDLKPENIL  321 (586)
T ss_pred             HHHHHHHHHHHHHHhCCeeeccCChhhee
Confidence            45689999999999999999999999998


No 361
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase. Protein kinases (PKs), MAP/ERK kinase (MEK) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MEK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MEK1 and MEK2 are dual-specificity PKs that phosphorylate and activate the down
Probab=76.96  E-value=1.2  Score=39.48  Aligned_cols=29  Identities=17%  Similarity=0.228  Sum_probs=25.4

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .-..+|+.+|.+||+ ..|+|+|.++.|||
T Consensus       103 ~~~~~i~~~l~~lH~~~~i~H~dl~p~nil  132 (308)
T cd06615         103 KISIAVLRGLTYLREKHKIMHRDVKPSNIL  132 (308)
T ss_pred             HHHHHHHHHHHHHHhhCCEEECCCChHHEE
Confidence            445789999999997 47999999999987


No 362
>KOG0582 consensus Ste20-like serine/threonine protein kinase [Signal transduction mechanisms]
Probab=76.75  E-value=1.1  Score=45.58  Aligned_cols=26  Identities=15%  Similarity=0.184  Sum_probs=24.7

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ++++++|.|||.+.-||||.|+.+||
T Consensus       133 re~LkaL~YLH~~G~IHRdvKAgnIL  158 (516)
T KOG0582|consen  133 REVLKALDYLHQNGHIHRDVKAGNIL  158 (516)
T ss_pred             HHHHHHHHHHHhcCceecccccccEE
Confidence            67889999999999999999999997


No 363
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1. Serine/Threonine Kinases (STKs), Phosphoinositide-dependent kinase 1 (PDK1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PDK1 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). PDK1 carries an N-terminal catalytic domain and a C-terminal pleckstrin homology (PH) domain that binds phosphoinositides. It phosphorylates the activation loop of AGC kinases that are regulated by PI3K such as PKB, SGK, and PKC, among others, and is crucial for their activation. Thus, it contributes in regulating many processes including metabolism, growth, proliferation, and survival. PDK1 also has the ability to auto
Probab=76.35  E-value=1.4  Score=37.24  Aligned_cols=30  Identities=13%  Similarity=0.113  Sum_probs=26.8

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..-..+|+.+|.+||+..|.|+|.++.||+
T Consensus       105 ~~i~~ql~~~l~~Lh~~~~~H~dl~~~ni~  134 (280)
T cd05581         105 RFYAAEILLALEYLHSKGIIHRDLKPENIL  134 (280)
T ss_pred             HHHHHHHHHHHHHHHHCCeeecCCCHHHeE
Confidence            344578999999999999999999999998


No 364
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 1 (Nek1) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek1 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. Nek1 is associated with centrosomes throughout the cell cycle. It is involved in the formation of primary cilium and in the maintenance of centrosomes. It cycles through the nucleus and may be capable of relaying signals between the cilium and the nucleus. Nek1 is implicated in the development of polycysti
Probab=75.98  E-value=1.3  Score=37.25  Aligned_cols=28  Identities=11%  Similarity=0.131  Sum_probs=25.2

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||++.|+|++.++.+|+
T Consensus       106 ~~~~l~~~l~~lh~~~i~h~~l~~~nil  133 (256)
T cd08218         106 WFVQICLALKHVHDRKILHRDIKSQNIF  133 (256)
T ss_pred             HHHHHHHHHHHHHhCCEecCCCCHHHEE
Confidence            3467999999999999999999999987


No 365
>cd00180 PKc Catalytic domain of Protein Kinases. Protein Kinases (PKs), catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The PK family is part of a larger superfamily that includes the catalytic domains of RIO kinases, aminoglycoside phosphotransferase, choline kinase, phosphoinositide 3-kinase (PI3K), and actin-fragmin kinase. PKs make up a large family of serine/threonine kinases, protein tyrosine kinases (PTKs), and dual-specificity PKs that phosphorylate both serine/threonine and tyrosine residues of target proteins. Majority of protein phosphorylation, about 95%, occurs on serine residues while only 1% occurs on tyrosine residues. Protein phosphorylation is a mechanism by which a wide variety of cellular proteins, such as enzymes and membrane channels, are reversibly regulated in response to certain stimuli. PKs often function as components of signal transduction pathways in which
Probab=75.97  E-value=1.4  Score=34.16  Aligned_cols=29  Identities=14%  Similarity=0.111  Sum_probs=25.6

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+..|++||++.|.|+|.++.||+
T Consensus        96 ~~~~~l~~~l~~lh~~~~~H~dl~~~ni~  124 (215)
T cd00180          96 RILLQILEGLEYLHSNGIIHRDLKPENIL  124 (215)
T ss_pred             HHHHHHHHHHHHHHhCCeeccCCCHhhEE
Confidence            34578899999999999999999999986


No 366
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase(MAPKK) subfamily, fungal Pek1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include 
Probab=75.69  E-value=1.5  Score=38.18  Aligned_cols=28  Identities=11%  Similarity=0.205  Sum_probs=25.0

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.+||++.|+|++.++.+|+
T Consensus       110 i~~~i~~~L~~lH~~~i~H~dl~~~nil  137 (287)
T cd06621         110 IAESVLKGLSYLHSRKIIHRDIKPSNIL  137 (287)
T ss_pred             HHHHHHHHHHHHHHCCcccCCCCHHHEE
Confidence            3467999999999999999999999876


No 367
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), AGC (Protein Kinases A, G and C) family, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The AGC family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and Phosphoinositide 3-Kinase (PI3K). Members of this family include cAMP-dependent Protein Kinase (PKA), cGMP-dependent Protein Kinase (PKG), Protein Kinase C (PKC), Protein Kinase B (PKB), G protein-coupled Receptor Kinase (GRK), Serum- and Glucocorticoid-induced Kinase (SGK), and 70 kDa ribosomal Protein S6 Kinase (p70S6K or S6K), among others. AGC kinases share an activation mechanism based on the phosphorylation of up to three sites: the activation loop (A-loop), the hydrophobic motif (HM) and the 
Probab=75.27  E-value=1.3  Score=36.84  Aligned_cols=29  Identities=14%  Similarity=0.071  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||...|+|++.++.+|+
T Consensus        97 ~~~~qi~~~l~~lh~~~~~H~~l~p~ni~  125 (250)
T cd05123          97 FYAAEIVLALEYLHSLGIIYRDLKPENIL  125 (250)
T ss_pred             HHHHHHHHHHHHHHHCCceecCCCcceEE
Confidence            34568999999999999999999999986


No 368
>KOG1167 consensus Serine/threonine protein kinase of the CDC7 subfamily involved in DNA synthesis, repair and recombination [Replication, recombination and repair]
Probab=75.27  E-value=1.5  Score=43.72  Aligned_cols=30  Identities=7%  Similarity=0.045  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..-..++..|.+||.+.|+|||+|+.|+|.
T Consensus       136 ~Yl~~ll~Al~~~h~~GIvHRDiKpsNFL~  165 (418)
T KOG1167|consen  136 WYLRNLLKALAHLHKNGIVHRDIKPSNFLY  165 (418)
T ss_pred             HHHHHHHHHhhhhhccCccccCCCcccccc
Confidence            445678899999999999999999999986


No 369
>KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms]
Probab=74.19  E-value=1.4  Score=44.46  Aligned_cols=42  Identities=17%  Similarity=0.149  Sum_probs=35.4

Q ss_pred             ccCCCCcchhHHHHHHhhhhccccccccCcchhhhH----hhhhcc
Q 024658          217 RDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT----GICRLS  258 (264)
Q Consensus       217 ~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l~  258 (264)
                      +.-++-.+.+.+|-++..||..+.+||||.|+.|||    .+||.+
T Consensus       300 l~~~~Ll~~a~qIaeGM~YLes~~~IHRDLAARNiLV~~~~~vKIs  345 (468)
T KOG0197|consen  300 LNLPQLLDFAAQIAEGMAYLESKNYIHRDLAARNILVDEDLVVKIS  345 (468)
T ss_pred             cchHHHHHHHHHHHHHHHHHHhCCccchhhhhhheeeccCceEEEc
Confidence            445566788999999999999999999999999998    456544


No 370
>KOG0599 consensus Phosphorylase kinase gamma subunit [Carbohydrate transport and metabolism]
Probab=73.95  E-value=1.4  Score=43.04  Aligned_cols=31  Identities=6%  Similarity=-0.001  Sum_probs=27.3

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhHhh
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAITGI  254 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~i  254 (264)
                      +--++|.+++.+||...|.|||.|+-|||-+
T Consensus       127 ~iMrqlfegVeylHa~~IVHRDLKpENILld  157 (411)
T KOG0599|consen  127 RIMRQLFEGVEYLHARNIVHRDLKPENILLD  157 (411)
T ss_pred             HHHHHHHHHHHHHHHhhhhhcccChhheeec
Confidence            3457888999999999999999999999854


No 371
>cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7. Protein kinases (PKs), MAP kinase kinase 7 (MKK7) subfamily, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MKK7 subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). MKK7 is a dual-specificity PK that phosphorylates and activates it
Probab=73.88  E-value=1.6  Score=38.10  Aligned_cols=29  Identities=17%  Similarity=0.245  Sum_probs=25.3

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+ ..|+|+|.++.+|+
T Consensus       118 ~i~~~i~~~l~~lH~~~~i~H~dl~p~nil  147 (296)
T cd06618         118 KMTVAIVKALHYLKEKHGVIHRDVKPSNIL  147 (296)
T ss_pred             HHHHHHHHHHHHHHhhCCEecCCCcHHHEE
Confidence            455789999999996 58999999999986


No 372
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAK deregulation is associated with tumor development. PAKs from higher eukaryotes are classified into two grou
Probab=73.82  E-value=1.6  Score=37.70  Aligned_cols=32  Identities=16%  Similarity=0.160  Sum_probs=27.4

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +...-..+|+.+|.+||+..|+|++.++.+|+
T Consensus       117 ~~~~i~~~i~~~L~~lH~~gi~H~dl~p~ni~  148 (286)
T cd06614         117 QIAYVCREVLQGLEYLHSQNVIHRDIKSDNIL  148 (286)
T ss_pred             HHHHHHHHHHHHHHHHHhCCeeeCCCChhhEE
Confidence            34445678999999999999999999999985


No 373
>KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=73.68  E-value=1.7  Score=42.04  Aligned_cols=35  Identities=6%  Similarity=0.056  Sum_probs=29.7

Q ss_pred             CCCCcchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          219 HGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       219 ~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .-.+..--++|++.+++||+..|.|||.|+-|||=
T Consensus       134 E~da~~~~~~il~av~~lH~~gvvHrDlKpEN~L~  168 (382)
T KOG0032|consen  134 ERDAAGIIRQILEAVKYLHSLGVVHRDLKPENLLL  168 (382)
T ss_pred             HHHHHHHHHHHHHHHHHHHhCCceeccCCHHHeee
Confidence            33455667899999999999999999999999873


No 374
>KOG0589 consensus Serine/threonine protein kinase [General function prediction only]
Probab=73.67  E-value=1.7  Score=43.38  Aligned_cols=28  Identities=14%  Similarity=0.100  Sum_probs=25.9

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -.++|+-.++|||.+-|.|||.|.+|||
T Consensus       111 ~~~Q~~~av~ylH~~~iLHRDlK~~Nif  138 (426)
T KOG0589|consen  111 WFVQILLAVNYLHENRVLHRDLKCANIF  138 (426)
T ss_pred             HHHHHHHHHHHHHhhhhhcccchhhhhh
Confidence            3469999999999999999999999997


No 375
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=73.43  E-value=1.3  Score=41.95  Aligned_cols=7  Identities=43%  Similarity=0.710  Sum_probs=2.5

Q ss_pred             ccCCcee
Q 024658          130 DDENQVV  136 (264)
Q Consensus       130 ~~enqvV  136 (264)
                      +.+|.||
T Consensus       329 ~~~~~~~  335 (375)
T PF03153_consen  329 DTDNVVL  335 (375)
T ss_dssp             TTS-EEE
T ss_pred             CcCCEEE
Confidence            4444443


No 376
>KOG0616 consensus cAMP-dependent protein kinase catalytic subunit (PKA) [Signal transduction mechanisms]
Probab=72.89  E-value=1.9  Score=42.17  Aligned_cols=27  Identities=11%  Similarity=0.132  Sum_probs=25.7

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.+||-.|+|||+..|+-||.|+-|||
T Consensus       150 AAeivlAleylH~~~iiYRDLKPENiL  176 (355)
T KOG0616|consen  150 AAEIVLALEYLHSLDIIYRDLKPENLL  176 (355)
T ss_pred             HHHHHHHHHHHHhcCeeeccCChHHee
Confidence            678999999999999999999999997


No 377
>KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms]
Probab=72.67  E-value=1.7  Score=43.89  Aligned_cols=29  Identities=14%  Similarity=0.000  Sum_probs=24.5

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ........||.|||++.+||||+|+-|+|
T Consensus       266 ~~~~~AA~Gl~YLh~k~~IHRDIAARNcL  294 (474)
T KOG0194|consen  266 RFCYDAARGLEYLHSKNCIHRDIAARNCL  294 (474)
T ss_pred             HHHHHHHhHHHHHHHCCCcchhHhHHHhe
Confidence            34456677999999999999999998876


No 378
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase. Serine/threonine kinases (STKs), p21-activated kinase (PAK) subfamily, Group I, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The PAK subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. PAKs are Rho family GTPase-regulated kinases that serve as important mediators in the function of Cdc42 (cell division cycle 42) and Rac. PAKs are implicated in the regulation of many cellular processes including growth factor receptor-mediated proliferation, cell polarity, cell motility, cell death and survival, and actin cytoskeleton organization. PAKs from higher eukaryotes are classified into two groups (I and II), according to their bi
Probab=72.56  E-value=1.8  Score=38.04  Aligned_cols=29  Identities=10%  Similarity=0.117  Sum_probs=25.8

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||.+.|+|+|.++.||+
T Consensus       119 ~i~~~l~~al~~LH~~gi~H~dL~p~Nil  147 (293)
T cd06647         119 AVCRECLQALEFLHSNQVIHRDIKSDNIL  147 (293)
T ss_pred             HHHHHHHHHHHHHHhCCEeeccCCHHHEE
Confidence            34568899999999999999999999986


No 379
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10. Serine/Threonine Kinases (STKs), Never In Mitosis gene A (NIMA)-related kinase 10 (Nek10) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Nek10 subfamily is one of a family of 11 different Neks (Nek1-11) that are involved in cell cycle control. The Nek family is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. No function has yet been ascribed to Nek10. The gene encoding Nek10 is a putative causative gene for breast cancer; it is located within a breast cancer susceptibility loci on chromosome 3p24.
Probab=72.45  E-value=1.9  Score=36.70  Aligned_cols=28  Identities=14%  Similarity=0.185  Sum_probs=24.1

Q ss_pred             hhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||. +.|+|+|.++.|||
T Consensus       118 ~~~~l~~~l~~lh~~~~i~H~dl~~~nil  146 (269)
T cd08528         118 IFVQMVLALRYLHKEKRIVHRDLTPNNIM  146 (269)
T ss_pred             HHHHHHHHHHHhccCCceeecCCCHHHEE
Confidence            34578999999995 67999999999986


No 380
>KOG2345 consensus Serine/threonine protein kinase/TGF-beta stimulated factor [Transcription; Lipid transport and metabolism; Signal transduction mechanisms]
Probab=71.80  E-value=1.7  Score=41.59  Aligned_cols=25  Identities=20%  Similarity=0.259  Sum_probs=23.0

Q ss_pred             HHHHHhhhhcccc--ccccCcchhhhH
Q 024658          228 AIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .|.++|+.||...  ..|+|+|+||||
T Consensus       135 gic~gL~~lH~~~~~yAH~DiKP~NIL  161 (302)
T KOG2345|consen  135 GICRGLEALHEKEPPYAHRDIKPANIL  161 (302)
T ss_pred             HHHHHHHHHhccCCcccccCCCcceeE
Confidence            4678999999999  999999999997


No 381
>KOG0607 consensus MAP kinase-interacting kinase and related serine/threonine protein kinases [Signal transduction mechanisms]
Probab=71.72  E-value=1.2  Score=44.26  Aligned_cols=27  Identities=19%  Similarity=0.154  Sum_probs=24.2

Q ss_pred             HHHHHHhhhhccccccccCcchhhhHh
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      ..|-..|.-||+|.|-|||.|+-|||-
T Consensus       183 kdia~aLdFlH~kgIAHRDlKPENiLC  209 (463)
T KOG0607|consen  183 KDIASALDFLHTKGIAHRDLKPENILC  209 (463)
T ss_pred             HHHHHHHHHHhhcCcccccCCccceee
Confidence            456779999999999999999999973


No 382
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3. Serine/threonine kinases (STKs), mammalian Ste20-like protein kinase 3 (MST3) subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The MST3 subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. MST3 phosphorylates the STK NDR and may play a role in cell cycle progression and cell morphology. It may also regulate paxillin and consequently, cell migration. MST3 is present in human placenta, where it plays an essential role in the oxidative stress-induced apoptosis of trophoblasts in normal spontaneous delivery. Dysregulation of trophoblast apoptosis may result in pregnancy complications such as preeclampsia and int
Probab=71.32  E-value=2.3  Score=36.68  Aligned_cols=30  Identities=17%  Similarity=0.156  Sum_probs=26.3

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||.+.|+|+|.++.||+
T Consensus       104 ~~~~~~l~~~l~~lh~~~i~h~dl~p~Ni~  133 (277)
T cd06641         104 ATILREILKGLDYLHSEKKIHRDIKAANVL  133 (277)
T ss_pred             HHHHHHHHHHHHHHccCCeecCCCCHHhEE
Confidence            345578899999999999999999999986


No 383
>PTZ00266 NIMA-related protein kinase; Provisional
Probab=71.11  E-value=2.1  Score=46.94  Aligned_cols=28  Identities=11%  Similarity=0.110  Sum_probs=24.7

Q ss_pred             hhHHHHHHhhhhcc-------ccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQN-------QTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~-------~~i~~~d~~~a~i~  252 (264)
                      ...+|+.+|.+||+       +.|+|+|+++.|||
T Consensus       123 Ia~QIL~ALaYLHs~g~~~~~k~IVHRDLKPeNIL  157 (1021)
T PTZ00266        123 ITRQLLHALAYCHNLKDGPNGERVLHRDLKPQNIF  157 (1021)
T ss_pred             HHHHHHHHHHHHHhcccccccCCceeccCcHHHeE
Confidence            45789999999998       44999999999997


No 384
>KOG0665 consensus Jun-N-terminal kinase (JNK) [Signal transduction mechanisms]
Probab=70.64  E-value=1.9  Score=42.36  Aligned_cols=29  Identities=7%  Similarity=0.126  Sum_probs=25.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-+-++.-++++||+..|+|||.|+.||+
T Consensus       122 ~i~yq~~~~ik~lhs~~IihRdLkPsniv  150 (369)
T KOG0665|consen  122 YILYQMLCGIKHLHSAGIIHRDLKPSNIV  150 (369)
T ss_pred             HHHHHHHHHHHHHHhcceeecccCcccce
Confidence            34568888999999999999999999985


No 385
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain. Phosphotransferases. Serine or threonine-specific kinase subfamily.
Probab=70.56  E-value=2.3  Score=34.36  Aligned_cols=30  Identities=17%  Similarity=0.141  Sum_probs=26.4

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+..|.|++..+.+|+
T Consensus        90 ~~~~~~l~~~l~~lh~~~i~h~~i~~~ni~  119 (244)
T smart00220       90 RFYARQILSALEYLHSNGIIHRDLKPENIL  119 (244)
T ss_pred             HHHHHHHHHHHHHHHHcCeecCCcCHHHeE
Confidence            345678999999999999999999999986


No 386
>PLN02400 cellulose synthase
Probab=70.26  E-value=4.4  Score=44.83  Aligned_cols=30  Identities=17%  Similarity=0.351  Sum_probs=23.7

Q ss_pred             cccccccCCC----CceecccCCCCcccCchhhh
Q 024658           45 LCHVCQSLTP----WKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        45 LC~~C~~~p~----~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      +|+.|...-.    --..+.|..|+-++|..|.-
T Consensus        38 iCqICGD~VG~t~dGe~FVAC~eCaFPVCRpCYE   71 (1085)
T PLN02400         38 ICQICGDDVGVTETGDVFVACNECAFPVCRPCYE   71 (1085)
T ss_pred             eeeecccccCcCCCCCEEEEEccCCCccccchhh
Confidence            7889975322    22678999999999999986


No 387
>KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=69.56  E-value=2.3  Score=41.62  Aligned_cols=26  Identities=15%  Similarity=0.109  Sum_probs=23.3

Q ss_pred             HHHHHHhhhhcc----ccccccCcchhhhH
Q 024658          227 TAIISSLRGLQN----QTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~----~~i~~~d~~~a~i~  252 (264)
                      +++...|.+.|+    +.|.|||+|+||||
T Consensus       131 ~QL~~AL~~cH~~~~r~~VmHRDIKPaNIF  160 (375)
T KOG0591|consen  131 VQLCRALYHCHSKIPRGTVMHRDIKPANIF  160 (375)
T ss_pred             HHHHHHHHHHhccccccceeeccCcchheE
Confidence            688889999999    56999999999997


No 388
>PLN02189 cellulose synthase
Probab=69.07  E-value=5.2  Score=44.12  Aligned_cols=30  Identities=17%  Similarity=0.321  Sum_probs=23.9

Q ss_pred             cccccccC----CCCceecccCCCCcccCchhhh
Q 024658           45 LCHVCQSL----TPWKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        45 LC~~C~~~----p~~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      +|+.|...    ..-...+.|..|+-++|..|.-
T Consensus        36 ~C~iCgd~vg~~~~g~~fvaC~~C~fpvCr~Cye   69 (1040)
T PLN02189         36 VCEICGDEIGLTVDGDLFVACNECGFPVCRPCYE   69 (1040)
T ss_pred             cccccccccCcCCCCCEEEeeccCCCccccchhh
Confidence            78888754    2233778999999999999986


No 389
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=68.80  E-value=4  Score=43.59  Aligned_cols=7  Identities=29%  Similarity=0.710  Sum_probs=3.0

Q ss_pred             hhhhccc
Q 024658          167 SLKRMRD  173 (264)
Q Consensus       167 ~~kr~r~  173 (264)
                      +++|+|.
T Consensus       446 iI~RIrk  452 (840)
T PF04147_consen  446 IIQRIRK  452 (840)
T ss_pred             HHHHHHH
Confidence            4444443


No 390
>PRK10359 lipopolysaccharide core biosynthesis protein; Provisional
Probab=67.07  E-value=2.8  Score=38.41  Aligned_cols=27  Identities=15%  Similarity=0.220  Sum_probs=24.9

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -.+|...|..||...|+|+|.+++||+
T Consensus       141 ~~~i~~~l~~lH~~gi~H~Dikp~Nil  167 (232)
T PRK10359        141 KAKIKASIESLHQHGMVSGDPHKGNFI  167 (232)
T ss_pred             HHHHHHHHHHHHHcCCccCCCChHHEE
Confidence            458999999999999999999999986


No 391
>PF03115 Astro_capsid:  Astrovirus capsid protein precursor;  InterPro: IPR004337 The astrovirus genome is apparently organised with nonstructural proteins encoded at the 5' end and structural proteins at the 3' end []. Proteins in this family are encoded by astrovirus ORF2, one of the three astrovirus ORFs (1a, 1b, 2). The proteins contain a viral RNA-dependent RNA polymerase motif []. The 87kDa precursor polyprotein undergoes an intracellular cleavage to form a 79kDa protein. Subsequently, extracellular trypsin cleavage yields the three proteins forming the infectious virion [].; PDB: 3QSQ_A 3TS3_D.
Probab=66.78  E-value=1.9  Score=46.19  Aligned_cols=6  Identities=50%  Similarity=0.535  Sum_probs=0.0

Q ss_pred             CceecC
Q 024658          133 NQVVPW  138 (264)
Q Consensus       133 nqvVp~  138 (264)
                      ||=+|-
T Consensus       719 NqGi~e  724 (787)
T PF03115_consen  719 NQGIPE  724 (787)
T ss_dssp             ------
T ss_pred             HcCCCH
Confidence            344433


No 392
>PHA02988 hypothetical protein; Provisional
Probab=66.04  E-value=3  Score=36.73  Aligned_cols=30  Identities=7%  Similarity=0.021  Sum_probs=25.2

Q ss_pred             cchhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      .....+|+.+|.+||+ ..|+|||.++++||
T Consensus       125 ~~i~~~i~~~l~~lH~~~~~~Hrdlkp~nil  155 (283)
T PHA02988        125 LDMAIDCCKGLYNLYKYTNKPYKNLTSVSFL  155 (283)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCCCcCChhhEE
Confidence            3445688999999997 48899999999986


No 393
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=65.94  E-value=5.1  Score=41.26  Aligned_cols=11  Identities=18%  Similarity=0.691  Sum_probs=7.0

Q ss_pred             ccccccCCCCc
Q 024658           46 CHVCQSLTPWK   56 (264)
Q Consensus        46 C~~C~~~p~~k   56 (264)
                      |+.|+.+..|+
T Consensus       143 mD~cEn~~hwh  153 (615)
T KOG3540|consen  143 MDQCENNQHWH  153 (615)
T ss_pred             cccccchHHHH
Confidence            45677666655


No 394
>KOG0986 consensus G protein-coupled receptor kinase [Signal transduction mechanisms]
Probab=63.92  E-value=3.4  Score=42.53  Aligned_cols=29  Identities=17%  Similarity=0.174  Sum_probs=26.7

Q ss_pred             chhHHHHHHhhhhccccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      =-+++|+=+|..||+.-|.-||.|++|||
T Consensus       291 FYAAEi~cGLehlH~~~iVYRDLKPeNIL  319 (591)
T KOG0986|consen  291 FYAAEIICGLEHLHRRRIVYRDLKPENIL  319 (591)
T ss_pred             HHHHHHHhhHHHHHhcceeeccCChhhee
Confidence            34688999999999999999999999997


No 395
>KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms]
Probab=62.57  E-value=2  Score=44.04  Aligned_cols=26  Identities=12%  Similarity=0.155  Sum_probs=25.1

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -||+.||+++|+-.+-|||.|+-|||
T Consensus       117 ~QilqGL~hiHk~GfFHRDlKPENiL  142 (538)
T KOG0661|consen  117 YQILQGLAHIHKHGFFHRDLKPENIL  142 (538)
T ss_pred             HHHHHHHHHHHhcCcccccCChhheE
Confidence            79999999999999999999999996


No 396
>KOG0033 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms]
Probab=62.11  E-value=4.3  Score=39.24  Aligned_cols=28  Identities=7%  Similarity=0.063  Sum_probs=25.4

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -.+||+++|+|-|...|+|||-++-++|
T Consensus       115 ~~rQiLeal~yCH~n~IvHRDvkP~nll  142 (355)
T KOG0033|consen  115 CIQQILEALAYCHSNGIVHRDLKPENLL  142 (355)
T ss_pred             HHHHHHHHHHHHHhcCceeccCChhhee
Confidence            3579999999999999999999998876


No 397
>PF04889 Cwf_Cwc_15:  Cwf15/Cwc15 cell cycle control protein;  InterPro: IPR006973 This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing [].; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=61.48  E-value=5.1  Score=37.11  Aligned_cols=11  Identities=45%  Similarity=0.519  Sum_probs=4.6

Q ss_pred             hhhhh-hccccC
Q 024658          165 DFSLK-RMRDFG  175 (264)
Q Consensus       165 ~~~~k-r~r~~~  175 (264)
                      .|.+| |.|..+
T Consensus       197 ~~~~kr~W~ddv  208 (244)
T PF04889_consen  197 DFKVKRRWDDDV  208 (244)
T ss_pred             CCccccCCcccc
Confidence            34444 334443


No 398
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases. Protein kinases (PKs), MAP kinase kinase (MAPKK) subfamily, fungal Byr1-like proteins, catalytic (c) domain. PKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine or tyrosine residues on protein substrates. The MAPKK subfamily is part of a larger superfamily that includes the catalytic domains of other protein serine/threonine kinases, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. The mitogen-activated protein (MAP) kinase signaling pathways are important mediators of cellular responses to extracellular signals. The pathways involve a triple kinase core cascade comprising of the MAP kinase (MAPK), which is phosphorylated and activated by a MAPK kinase (MAPKK or MKK), which itself is phosphorylated and activated by a MAPK kinase kinase (MAPKKK or MKKK). Members of this group include
Probab=61.11  E-value=4.4  Score=35.03  Aligned_cols=29  Identities=17%  Similarity=0.213  Sum_probs=24.8

Q ss_pred             chhHHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      ....+|+.+|.+||+ ..|+|++.++.+|+
T Consensus       107 ~~~~~i~~~l~~LH~~~~i~H~dl~p~nil  136 (284)
T cd06620         107 KIAVAVVEGLTYLYNVHRIMHRDIKPSNIL  136 (284)
T ss_pred             HHHHHHHHHHHHHHHhcCeeccCCCHHHEE
Confidence            445678999999996 47999999999987


No 399
>KOG0983 consensus Mitogen-activated protein kinase (MAPK) kinase MKK7/JNKK2 [Signal transduction mechanisms]
Probab=60.94  E-value=3.9  Score=40.06  Aligned_cols=27  Identities=19%  Similarity=0.257  Sum_probs=23.0

Q ss_pred             hHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      +-+||+.|-||-.| .|||||.|++|||
T Consensus       197 tva~v~AL~YLKeKH~viHRDvKPSNIL  224 (391)
T KOG0983|consen  197 TVAIVKALYYLKEKHGVIHRDVKPSNIL  224 (391)
T ss_pred             HHHHHHHHHHHHHhcceeecccCccceE
Confidence            46899999998533 7999999999997


No 400
>smart00221 STYKc Protein kinase; unclassified specificity. Phosphotransferases. The specificity of this class of kinases can not be predicted. Possible dual-specificity Ser/Thr/Tyr kinase.
Probab=60.81  E-value=4.9  Score=32.44  Aligned_cols=31  Identities=13%  Similarity=0.074  Sum_probs=26.4

Q ss_pred             CcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          222 SVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       222 ~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+...+|+.+|.+||++.|.|++.++.+|+
T Consensus       100 ~~~~~~~l~~~l~~lh~~~i~h~di~~~ni~  130 (225)
T smart00221      100 ARFYLRQILEALEYLHSLGIVHRDLKPENIL  130 (225)
T ss_pred             HHHHHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            3445578899999999999999999999875


No 401
>KOG1166 consensus Mitotic checkpoint serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning]
Probab=59.95  E-value=4.3  Score=44.46  Aligned_cols=37  Identities=8%  Similarity=-0.047  Sum_probs=32.8

Q ss_pred             cccCCCCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          216 DRDHGQSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       216 v~~~~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +-++.-....+++|+.-++.||...|||+|+|+-|.+
T Consensus       790 ~m~e~lv~~~~~qml~ive~lH~~~IIHgDiKPDNfl  826 (974)
T KOG1166|consen  790 VMDEYLVMFFSCQMLRIVEHLHAMGIIHGDIKPDNFL  826 (974)
T ss_pred             CCCchhhhHHHHHHHHHHHHHHhcceecccCCcceeE
Confidence            3567778899999999999999999999999998753


No 402
>KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=59.70  E-value=3.3  Score=44.13  Aligned_cols=30  Identities=20%  Similarity=0.304  Sum_probs=25.5

Q ss_pred             HHHHHhhhhccccccccCcchhhhH----hhhhc
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT----GICRL  257 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l  257 (264)
                      ..+.+|.|||+-.+||||+|+.|||    ||=||
T Consensus       134 gaL~gLaYLHS~~~IHRDiKAGNILLse~g~VKL  167 (948)
T KOG0577|consen  134 GALQGLAYLHSHNRIHRDIKAGNILLSEPGLVKL  167 (948)
T ss_pred             HHHHHHHHHHHhhHHhhhccccceEecCCCeeee
Confidence            3477999999999999999999998    55554


No 403
>KOG1027 consensus Serine/threonine protein kinase and endoribonuclease ERN1/IRE1, sensor of the unfolded protein response pathway [Signal transduction mechanisms]
Probab=59.58  E-value=3.8  Score=44.37  Aligned_cols=31  Identities=19%  Similarity=0.142  Sum_probs=27.0

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhHh
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAITG  253 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~~  253 (264)
                      .+--.+|+++|.+||+-.|+|||.|+-|||=
T Consensus       609 ~~~l~q~~~GlaHLHsl~iVHRDLkPQNILI  639 (903)
T KOG1027|consen  609 ISVLSQIASGLAHLHSLKIVHRDLKPQNILI  639 (903)
T ss_pred             HHHHHHHHHHHHHHHhcccccccCCCceEEE
Confidence            3445789999999999999999999999973


No 404
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional
Probab=59.16  E-value=5.2  Score=41.65  Aligned_cols=28  Identities=18%  Similarity=0.139  Sum_probs=24.8

Q ss_pred             hhHHHHHHhhhhc---cccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQ---NQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~---~~~i~~~d~~~a~i~  252 (264)
                      -..+|+.+|.|||   .+.|+|||.|+++|+
T Consensus       785 i~~~ia~~L~yLH~~~~~~iiH~dlkp~Nil  815 (968)
T PLN00113        785 IAIGIAKALRFLHCRCSPAVVVGNLSPEKII  815 (968)
T ss_pred             HHHHHHHHHHHhccCCCCCeecCCCCHHhEE
Confidence            3467899999999   779999999999986


No 405
>KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms]
Probab=57.96  E-value=4.7  Score=42.86  Aligned_cols=36  Identities=19%  Similarity=0.274  Sum_probs=28.1

Q ss_pred             ccCCCCcchh----HHHHHHhhhhccccccccCcchhhhH
Q 024658          217 RDHGQSVSRS----TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       217 ~~~~~~~s~~----t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -.-|.+++--    .+|+.+|++||.-.|+|||+|+-||+
T Consensus       113 N~~GLpE~e~l~lL~d~~~al~~LrEn~IvHRDlKP~NIv  152 (732)
T KOG4250|consen  113 NAYGLPESEFLDLLSDLVSALRHLRENGIVHRDLKPGNIV  152 (732)
T ss_pred             cccCCCHHHHHHHHHHHHHHHHHHHHcCceeccCCCCcEE
Confidence            4455555443    45667999999999999999999985


No 406
>PLN02436 cellulose synthase A
Probab=57.90  E-value=11  Score=41.94  Aligned_cols=30  Identities=17%  Similarity=0.335  Sum_probs=23.7

Q ss_pred             cccccccCCC----CceecccCCCCcccCchhhh
Q 024658           45 LCHVCQSLTP----WKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        45 LC~~C~~~p~----~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      +|+.|...-.    --..+.|..|+-++|..|.-
T Consensus        38 iCqICGD~Vg~t~dGe~FVACn~C~fpvCr~Cye   71 (1094)
T PLN02436         38 TCQICGDEIELTVDGEPFVACNECAFPVCRPCYE   71 (1094)
T ss_pred             cccccccccCcCCCCCEEEeeccCCCccccchhh
Confidence            7889975322    23678999999999999986


No 407
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=56.85  E-value=8.7  Score=38.89  Aligned_cols=7  Identities=43%  Similarity=0.510  Sum_probs=4.1

Q ss_pred             hhhhccc
Q 024658          167 SLKRMRD  173 (264)
Q Consensus       167 ~~kr~r~  173 (264)
                      ..||.|.
T Consensus       339 ~~~r~~~  345 (514)
T KOG3130|consen  339 EAKRKRK  345 (514)
T ss_pred             HHHHHHh
Confidence            4556665


No 408
>KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms]
Probab=56.26  E-value=3  Score=40.55  Aligned_cols=26  Identities=15%  Similarity=0.201  Sum_probs=21.0

Q ss_pred             HHHHHHhhhhcc-ccccccCcchhhhH
Q 024658          227 TAIISSLRGLQN-QTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~-~~i~~~d~~~a~i~  252 (264)
                      -++|+.|+||-. -.|||||.|++|||
T Consensus       174 vatV~AL~yLK~~lkiIHRDvKPSNIL  200 (361)
T KOG1006|consen  174 VATVDALDYLKEELKIIHRDVKPSNIL  200 (361)
T ss_pred             eeehhHHHHHHHHhhhhhccCChhheE
Confidence            367888888853 37999999999995


No 409
>KOG1152 consensus Signal transduction serine/threonine kinase with PAS/PAC sensor domain [Signal transduction mechanisms]
Probab=56.10  E-value=4.8  Score=42.59  Aligned_cols=32  Identities=6%  Similarity=0.166  Sum_probs=26.0

Q ss_pred             CCCcchhHHHHHHhhhhccccccccCcchhhh
Q 024658          220 GQSVSRSTAIISSLRGLQNQTMTDQGDAAAAI  251 (264)
Q Consensus       220 ~~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i  251 (264)
                      +++----.||+-+++.||.|.|+|||+|--|+
T Consensus       670 ~eAk~IFkQV~agi~hlh~~~ivhrdikdenv  701 (772)
T KOG1152|consen  670 PEAKLIFKQVVAGIKHLHDQGIVHRDIKDENV  701 (772)
T ss_pred             HHHHHHHHHHHhccccccccCceecccccccE
Confidence            33444457899999999999999999998765


No 410
>KOG0699 consensus Serine/threonine protein phosphatase [Signal transduction mechanisms]
Probab=56.06  E-value=7.5  Score=39.17  Aligned_cols=22  Identities=36%  Similarity=0.660  Sum_probs=15.0

Q ss_pred             CCCCCCcchhhccccCCceecC
Q 024658          117 DDDEDPDEEEEEEDDENQVVPW  138 (264)
Q Consensus       117 dd~e~e~~~~~ee~~enqvVp~  138 (264)
                      +||..+++.++||..|.|.+|.
T Consensus       295 ~Ded~e~e~ddEE~~e~~map~  316 (542)
T KOG0699|consen  295 DDEDAEDEQDDEEMVEGSMAPL  316 (542)
T ss_pred             cccccccccchhhhhhhccccc
Confidence            3334444566777788899998


No 411
>cd05151 ChoK Choline Kinase (ChoK). The ChoK subfamily is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). It is composed of bacterial and eukaryotic choline kinases, as well as eukaryotic ethanolamine kinase. ChoK catalyzes the transfer of the gamma-phosphoryl group from ATP (or CTP) to its substrate, choline, producing phosphorylcholine (PCho), a precursor to the biosynthesis of two major membrane phospholipids, phosphatidylcholine (PC), and sphingomyelin (SM). Although choline is the preferred substrate, ChoK also shows substantial activity towards ethanolamine and its N-methylated derivatives. Bacterial ChoK is also referred to as licA protein. ETNK catalyzes the transfer of the gamma-phosphoryl group from CTP to ethanolamine (Etn), the first step in the CDP-Etn pathway for the formation of the major ph
Probab=55.12  E-value=6.8  Score=31.17  Aligned_cols=28  Identities=11%  Similarity=0.114  Sum_probs=24.5

Q ss_pred             hhHHHHHHhhhhccccc-----cccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTM-----TDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i-----~~~d~~~a~i~  252 (264)
                      ...+|+..|.+||+..+     +|+|.++.||+
T Consensus        88 ~~~~l~~~l~~LH~~~~~~~~~~HgD~~~~Nil  120 (170)
T cd05151          88 NLEKIAKLLKKLHSSPLPDLVPCHNDLLPGNFL  120 (170)
T ss_pred             HHHHHHHHHHHHhCCCCCCceeecCCCCcCcEE
Confidence            34689999999999886     99999999986


No 412
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family. The APH/ChoK family is part of a larger superfamily that includes the catalytic domains of other kinases, such as the typical serine/threonine/tyrosine protein kinases (PKs), RIO kinases, actin-fragmin kinase (AFK), and phosphoinositide 3-kinase (PI3K). The family is composed of APH, ChoK, ethanolamine kinase (ETNK), macrolide 2'-phosphotransferase (MPH2'), an unusual homoserine kinase, and uncharacterized proteins with similarity to the N-terminal domain of acyl-CoA dehydrogenase 10 (ACAD10). The members of this family catalyze the transfer of the gamma-phosphoryl group from ATP (or CTP) to small molecule substrates such as aminoglycosides, macrolides, choline, ethanolamine, and homoserine. Phosphorylation of the antibiotics, aminoglycosides and macrolides, leads to their inactivation and to bacterial antibiotic resistance. Phosphorylation of choline, ethanolamine, and homoserine serves 
Probab=54.91  E-value=6.3  Score=29.40  Aligned_cols=29  Identities=10%  Similarity=0.069  Sum_probs=24.1

Q ss_pred             chhHHHHHHhhhhccc---cccccCcchhhhH
Q 024658          224 SRSTAIISSLRGLQNQ---TMTDQGDAAAAIT  252 (264)
Q Consensus       224 s~~t~i~~sl~~l~~~---~i~~~d~~~a~i~  252 (264)
                      ....+|...|.+||..   .|+|+|.++.||+
T Consensus        90 ~~~~~~~~~l~~lh~~~~~~i~H~Dl~~~Nil  121 (155)
T cd05120          90 DIAEQLAELLAKLHQLPLLVLCHGDLHPGNIL  121 (155)
T ss_pred             HHHHHHHHHHHHHhCCCceEEEecCCCcceEE
Confidence            4456788899999975   4999999999986


No 413
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=54.74  E-value=11  Score=39.47  Aligned_cols=51  Identities=18%  Similarity=0.430  Sum_probs=30.2

Q ss_pred             CCCCCCCCCCceEEecCCCcccccccCcccccccccCCcccccccccccccCCCCceecccCCCCccc
Q 024658            1 MRKCELCECPARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPTVSV   68 (264)
Q Consensus         1 m~~Cd~C~~pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~p~~ka~~~C~~d~~~L   68 (264)
                      |..|-.|+..     -.+.|++|..|.+++-        |   ..|..|...-+ ...-||..|+..+
T Consensus         1 M~~Cp~Cg~~-----n~~~akFC~~CG~~l~--------~---~~Cp~CG~~~~-~~~~fC~~CG~~~   51 (645)
T PRK14559          1 MLICPQCQFE-----NPNNNRFCQKCGTSLT--------H---KPCPQCGTEVP-VDEAHCPNCGAET   51 (645)
T ss_pred             CCcCCCCCCc-----CCCCCccccccCCCCC--------C---CcCCCCCCCCC-cccccccccCCcc
Confidence            8999999982     1245666777765542        1   24777765321 1445666666554


No 414
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=53.93  E-value=7.3  Score=39.40  Aligned_cols=6  Identities=17%  Similarity=0.507  Sum_probs=2.4

Q ss_pred             CceecC
Q 024658          133 NQVVPW  138 (264)
Q Consensus       133 nqvVp~  138 (264)
                      +-.+|-
T Consensus       304 dN~~p~  309 (514)
T KOG3130|consen  304 DNSIPT  309 (514)
T ss_pred             CCcCcc
Confidence            333443


No 415
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=52.76  E-value=4.6  Score=38.35  Aligned_cols=7  Identities=14%  Similarity=0.045  Sum_probs=0.0

Q ss_pred             ccCCCCC
Q 024658           96 RISGHDE  102 (264)
Q Consensus        96 ~~~~~d~  102 (264)
                      .+|.+|+
T Consensus       273 ~DG~~d~  279 (375)
T PF03153_consen  273 LDGAGDD  279 (375)
T ss_dssp             -------
T ss_pred             ccCCCCC
Confidence            4444444


No 416
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription]
Probab=51.94  E-value=11  Score=41.56  Aligned_cols=12  Identities=33%  Similarity=0.653  Sum_probs=7.5

Q ss_pred             CCCCCCCCCCcc
Q 024658          205 LKQPRPTISDCD  216 (264)
Q Consensus       205 lk~~~i~~~~~v  216 (264)
                      .|+|+|=+=++.
T Consensus       162 vkDP~LW~VKC~  173 (1024)
T KOG1999|consen  162 VKDPNLWIVKCK  173 (1024)
T ss_pred             CCCCCeeEEEec
Confidence            577777555554


No 417
>PTZ00007 (NAP-L) nucleosome assembly protein -L; Provisional
Probab=49.99  E-value=14  Score=35.98  Aligned_cols=13  Identities=8%  Similarity=-0.189  Sum_probs=8.0

Q ss_pred             cccccCCCCcccc
Q 024658           85 KAVVRGGSQSERI   97 (264)
Q Consensus        85 pV~~~~g~p~~~~   97 (264)
                      +|.=|+|-....+
T Consensus       271 AV~yftGea~d~~  283 (337)
T PTZ00007        271 AVYWFLGEAIDED  283 (337)
T ss_pred             cHHhhCCCccccc
Confidence            4556888766533


No 418
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=48.83  E-value=12  Score=39.20  Aligned_cols=26  Identities=35%  Similarity=0.656  Sum_probs=14.3

Q ss_pred             CCCCCCCCcchhhccccCCceecCCC
Q 024658          115 DDDDDEDPDEEEEEEDDENQVVPWSG  140 (264)
Q Consensus       115 ~~dd~e~e~~~~~ee~~enqvVp~s~  140 (264)
                      +++++|+|++..||+++.-|+.....
T Consensus       423 ~E~~~eee~e~~ee~~e~~qI~D~T~  448 (739)
T KOG2140|consen  423 SEDDDEEEDESVEEDEEKLQIIDMTE  448 (739)
T ss_pred             ccccccccccccccccccceeecccc
Confidence            44444445444455555777776654


No 419
>KOG3241 consensus Uncharacterized conserved protein [Function unknown]
Probab=48.05  E-value=14  Score=33.81  Aligned_cols=10  Identities=30%  Similarity=1.179  Sum_probs=3.9

Q ss_pred             ccccccCCCC
Q 024658           46 CHVCQSLTPW   55 (264)
Q Consensus        46 C~~C~~~p~~   55 (264)
                      |+.|.....|
T Consensus        45 CqRCkEqieW   54 (227)
T KOG3241|consen   45 CQRCKEQIEW   54 (227)
T ss_pred             HHHHHHHHHH
Confidence            4444333333


No 420
>PF04546 Sigma70_ner:  Sigma-70, non-essential region;  InterPro: IPR007631 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ].  This domain is found in the primary vegetative sigma factor. Its function is unclear, and it can be removed without apparent loss of function [, ].; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1SIG_A 3IYD_F.
Probab=47.31  E-value=10  Score=33.47  Aligned_cols=7  Identities=29%  Similarity=0.738  Sum_probs=3.6

Q ss_pred             hhhHhhh
Q 024658          249 AAITGIC  255 (264)
Q Consensus       249 a~i~~ic  255 (264)
                      -.|+-||
T Consensus       148 r~i~~l~  154 (211)
T PF04546_consen  148 RRIMRLC  154 (211)
T ss_dssp             HHHHHCC
T ss_pred             HHHHHHH
Confidence            3455555


No 421
>PF12773 DZR:  Double zinc ribbon
Probab=46.77  E-value=23  Score=24.18  Aligned_cols=40  Identities=15%  Similarity=0.208  Sum_probs=22.7

Q ss_pred             CCcccccccCcccccccccCCcccccccccccccCCCCceecccCCC
Q 024658           18 DQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGP   64 (264)
Q Consensus        18 D~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~p~~ka~~~C~~d   64 (264)
                      +.+.+|..|...+-      .......+|..|...- .....||..|
T Consensus        10 ~~~~fC~~CG~~l~------~~~~~~~~C~~Cg~~~-~~~~~fC~~C   49 (50)
T PF12773_consen   10 DDAKFCPHCGTPLP------PPDQSKKICPNCGAEN-PPNAKFCPNC   49 (50)
T ss_pred             ccccCChhhcCChh------hccCCCCCCcCCcCCC-cCCcCccCcc
Confidence            45777777776665      2344456677776532 2244555544


No 422
>KOG1345 consensus Serine/threonine kinase [Signal transduction mechanisms]
Probab=45.93  E-value=9.3  Score=37.45  Aligned_cols=27  Identities=11%  Similarity=0.207  Sum_probs=24.7

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +.|+...|.++|+|.|.|||.|.-|||
T Consensus       127 ~~ql~SAi~fMHsknlVHRdlK~eNiL  153 (378)
T KOG1345|consen  127 FAQLLSAIEFMHSKNLVHRDLKAENIL  153 (378)
T ss_pred             HHHHHHHHHHhhccchhhcccccceEE
Confidence            467888999999999999999999997


No 423
>KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only]
Probab=45.58  E-value=11  Score=39.06  Aligned_cols=27  Identities=0%  Similarity=0.053  Sum_probs=24.8

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+++|-.|+-||.-.|||||+||.|+|
T Consensus       247 iaE~vlAI~~iH~~gyIHRDIKPdNlL  273 (550)
T KOG0605|consen  247 IAETVLAIESIHQLGYIHRDIKPDNLL  273 (550)
T ss_pred             HHHHHHHHHHHHHcCcccccCChhhee
Confidence            477888999999999999999999986


No 424
>KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms]
Probab=45.53  E-value=11  Score=40.07  Aligned_cols=26  Identities=19%  Similarity=0.207  Sum_probs=22.3

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      |||+-.|+|||-|.|.|=|.|+-|||
T Consensus       671 tQIL~ALr~LH~knIvHCDLKPENVL  696 (888)
T KOG4236|consen  671 TQILVALRYLHFKNIVHCDLKPENVL  696 (888)
T ss_pred             HHHHHHHHHhhhcceeeccCCchhee
Confidence            67888888888888888888888886


No 425
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=44.73  E-value=16  Score=37.80  Aligned_cols=11  Identities=9%  Similarity=-0.342  Sum_probs=5.7

Q ss_pred             CccccccCCCC
Q 024658           83 DDKAVVRGGSQ   93 (264)
Q Consensus        83 r~pV~~~~g~p   93 (264)
                      ++.=+-|--||
T Consensus       180 ~F~GvEfVCCP  190 (615)
T KOG3540|consen  180 MFRGVEFVCCP  190 (615)
T ss_pred             cccCceEEeCC
Confidence            33334456677


No 426
>KOG0586 consensus Serine/threonine protein kinase [General function prediction only]
Probab=44.02  E-value=12  Score=39.07  Aligned_cols=27  Identities=15%  Similarity=0.161  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -.+|+.++.|||.|.|.|||.|.-|||
T Consensus       161 F~q~vsaveYcH~k~ivHrdLk~eNil  187 (596)
T KOG0586|consen  161 FRQIVSAVEYCHSKNIVHRDLKAENIL  187 (596)
T ss_pred             hHHHHHHHHHHhhcceeccccchhhcc
Confidence            368999999999999999999999986


No 427
>KOG1163 consensus Casein kinase (serine/threonine/tyrosine protein kinase) [Signal transduction mechanisms]
Probab=43.73  E-value=11  Score=36.47  Aligned_cols=26  Identities=4%  Similarity=0.086  Sum_probs=24.1

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .|||.-|+++|.+-.||||+|+-|.|
T Consensus       118 DQml~RiEyvH~r~fiHRDIKPdNFL  143 (341)
T KOG1163|consen  118 DQMLSRIEYVHLRNFIHRDIKPDNFL  143 (341)
T ss_pred             HHHHHHHHHHHhhccccccCCcccee
Confidence            47899999999999999999999875


No 428
>PF06293 Kdo:  Lipopolysaccharide kinase (Kdo/WaaP) family;  InterPro: IPR010440 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases. Protein kinases catalyse the transfer of the gamma phosphate from nucleotide triphosphates (often ATP) to one or more amino acid residues in a protein substrate side chain, resulting in a conformational change affecting protein function. Phosphoprotein phosphatases catalyse the reverse process. Protein kinases fall into three broad classes, characterised with respect to substrate specificity []:   Serine/threonine-protein kinases Tyrosine-protein kinases Dual specific protein kinases (e.g. MEK - phosphorylates both Thr and Tyr on target proteins)   Protein kinase function has been evolutionarily conserved from Escherichia coli to human []. Protein kinases play a role in a multitude of cellular processes, including division, proliferation, apoptosis, and differentiation []. Phosphorylation usually results in a functional change of the target protein by changing enzyme activity, cellular location, or association with other proteins. The catalytic subunits of protein kinases are highly conserved, and several structures have been solved [], leading to large screens to develop kinase-specific inhibitors for the treatments of a number of diseases []. This entry represents lipopolysaccharide kinases which are related to protein kinases IPR000719 from INTERPRO. This family includes waaP (rfaP) gene product is required for the addition of phosphate to O-4 of the first heptose residue of the lipopolysaccharide (LPS) inner core region. It has previously been shown that WaaP is necessary for resistance to hydrophobic and polycationic antimicrobials in E. coli and that it is required for virulence in invasive strains of Salmonella enterica [].; GO: 0005524 ATP binding, 0016773 phosphotransferase activity, alcohol group as acceptor, 0009103 lipopolysaccharide biosynthetic process, 0016020 membrane
Probab=43.24  E-value=12  Score=32.29  Aligned_cols=30  Identities=10%  Similarity=0.031  Sum_probs=25.6

Q ss_pred             cchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          223 VSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       223 ~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..--.+|..-+.+||.+.|.|+|....|||
T Consensus       121 ~~ll~~l~~~i~~lH~~gi~H~Dl~~~NIL  150 (206)
T PF06293_consen  121 RELLRALARLIAKLHDAGIYHGDLNPSNIL  150 (206)
T ss_pred             HHHHHHHHHHHHHHHHCcCCCCCCCcccEE
Confidence            344567777899999999999999999997


No 429
>PF14569 zf-UDP:  Zinc-binding RING-finger; PDB: 1WEO_A.
Probab=42.57  E-value=23  Score=28.31  Aligned_cols=36  Identities=19%  Similarity=0.357  Sum_probs=14.3

Q ss_pred             cccccccccccccCCC----CceecccCCCCcccCchhhh
Q 024658           39 KHLRCLLCHVCQSLTP----WKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        39 rH~RvpLC~~C~~~p~----~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      ++.-..+|+.|...-.    -...+.|..|+.++|..|.-
T Consensus         5 k~~~~qiCqiCGD~VGl~~~Ge~FVAC~eC~fPvCr~CyE   44 (80)
T PF14569_consen    5 KNLNGQICQICGDDVGLTENGEVFVACHECAFPVCRPCYE   44 (80)
T ss_dssp             S--SS-B-SSS--B--B-SSSSB--S-SSS-----HHHHH
T ss_pred             hhcCCcccccccCccccCCCCCEEEEEcccCCccchhHHH
Confidence            3444567888864322    33778899999999999976


No 430
>KOG0200 consensus Fibroblast/platelet-derived growth factor receptor and related receptor tyrosine kinases [Signal transduction mechanisms]
Probab=41.45  E-value=13  Score=37.97  Aligned_cols=32  Identities=16%  Similarity=0.090  Sum_probs=29.1

Q ss_pred             CCcchhHHHHHHhhhhccccccccCcchhhhH
Q 024658          221 QSVSRSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       221 ~~~s~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-.|+.-||..++.+|.++.++|||.|+=|||
T Consensus       419 dLlsfa~QIa~GMe~L~~~~~vHRDLAaRNVL  450 (609)
T KOG0200|consen  419 DLLSFAYQIANGMEYLASVPCVHRDLAARNVL  450 (609)
T ss_pred             HHHHHHHHHHHHHHHHhhCCccchhhhhhhEE
Confidence            34578899999999999999999999999997


No 431
>KOG1290 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=41.02  E-value=13  Score=38.74  Aligned_cols=27  Identities=7%  Similarity=0.164  Sum_probs=24.1

Q ss_pred             hHHHHHHhhhhccc-cccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQ-TMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~-~i~~~d~~~a~i~  252 (264)
                      ..+|+.+|.|||.+ .|||-|+|+-|||
T Consensus       193 ~~qvL~GLdYLH~ecgIIHTDlKPENvL  220 (590)
T KOG1290|consen  193 CRQVLTGLDYLHRECGIIHTDLKPENVL  220 (590)
T ss_pred             HHHHHHHHHHHHHhcCccccCCCcceee
Confidence            46788899999976 7999999999987


No 432
>cd05146 RIO3_euk RIO kinase family; eukaryotic RIO3, catalytic domain. The RIO kinase catalytic domain family is part of a larger superfamily, that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase (PI3K). RIO kinases are atypical protein serine kinases containing a kinase catalytic signature, but otherwise show very little sequence similarity to typical PKs. Serine kinases catalyze the transfer of the gamma-phosphoryl group from ATP to serine residues in protein substrates. The RIO catalytic domain is truncated compared to the catalytic domains of typical PKs, with deletions of the loops responsible for substrate binding. RIO3 is present only in multicellular eukaryotes. Its function is still unknown.
Probab=40.56  E-value=15  Score=32.73  Aligned_cols=27  Identities=7%  Similarity=0.133  Sum_probs=24.3

Q ss_pred             hHHHHHHhhhh-ccccccccCcchhhhH
Q 024658          226 STAIISSLRGL-QNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l-~~~~i~~~d~~~a~i~  252 (264)
                      -.+|+..|.+| |+..|+|+|....||+
T Consensus       130 ~~~i~~~l~~l~H~~glVHGDLs~~NIL  157 (197)
T cd05146         130 YYQVLSMMKQLYKECNLVHADLSEYNML  157 (197)
T ss_pred             HHHHHHHHHHHHHhCCeecCCCCHHHEE
Confidence            46888999888 8999999999999987


No 433
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]
Probab=39.77  E-value=18  Score=39.86  Aligned_cols=43  Identities=35%  Similarity=0.354  Sum_probs=0.0

Q ss_pred             ccCCCCccccCCCCCCCCCCCCC------------------CCCCCCCCCCCCcchhhccc
Q 024658           88 VRGGSQSERISGHDETDDDDDYE------------------DEDDDDDDDEDPDEEEEEED  130 (264)
Q Consensus        88 ~~~g~p~~~~~~~d~~~~dd~~~------------------ded~~~dd~e~e~~~~~ee~  130 (264)
                      .+.+-...-+.+.++++|+++.+                  |+|||+|++|.+.++++...
T Consensus       892 ~~~~~~~~~e~~~~d~dD~d~~d~d~~~~~~~~~~~~~~~~~~ddd~d~~~~~~~ed~~f~  952 (1010)
T KOG1991|consen  892 GEEEDDDEEEDFIDDEDDIDEDDQDYLDEYGELALEKEDSLDDDDDFDEDELDLEEDELFE  952 (1010)
T ss_pred             ccCCCCcchhhccCccccccccchhHHHhhccccccccccccccccccchhcccccccccc


No 434
>PTZ00429 beta-adaptin; Provisional
Probab=39.17  E-value=21  Score=38.07  Aligned_cols=17  Identities=18%  Similarity=0.038  Sum_probs=9.6

Q ss_pred             hhccccCCceecCCCCC
Q 024658          126 EEEEDDENQVVPWSGDD  142 (264)
Q Consensus       126 ~~ee~~enqvVp~s~~~  142 (264)
                      +|+||.++++-|-+-|+
T Consensus       613 ~~~~~~~~~~~~~~~~~  629 (746)
T PTZ00429        613 TEDDDAVELPSTPSMGT  629 (746)
T ss_pred             ccchhhccCCCCCCCCC
Confidence            34455566666665544


No 435
>KOG0610 consensus Putative serine/threonine protein kinase [General function prediction only]
Probab=38.47  E-value=12  Score=38.08  Aligned_cols=27  Identities=11%  Similarity=0.087  Sum_probs=25.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..+|+=.|+|||...|+-||.|+-|||
T Consensus       185 aAEvl~ALEYLHmlGivYRDLKPENIL  211 (459)
T KOG0610|consen  185 AAEVLLALEYLHMLGIVYRDLKPENIL  211 (459)
T ss_pred             HHHHHHHHHHHHhhceeeccCCcceeE
Confidence            467888999999999999999999997


No 436
>KOG3241 consensus Uncharacterized conserved protein [Function unknown]
Probab=38.42  E-value=23  Score=32.52  Aligned_cols=8  Identities=25%  Similarity=0.766  Sum_probs=3.7

Q ss_pred             cccccccC
Q 024658           20 ASLCWDCD   27 (264)
Q Consensus        20 A~LC~~CD   27 (264)
                      +..|+.|-
T Consensus        93 ~~vCAKC~  100 (227)
T KOG3241|consen   93 QKVCAKCC  100 (227)
T ss_pred             HHHHHHHh
Confidence            34444444


No 437
>KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms]
Probab=38.08  E-value=9  Score=38.15  Aligned_cols=30  Identities=23%  Similarity=0.336  Sum_probs=25.3

Q ss_pred             HHHHhhhhccccccccCcchhhhH----hhhhcc
Q 024658          229 IISSLRGLQNQTMTDQGDAAAAIT----GICRLS  258 (264)
Q Consensus       229 i~~sl~~l~~~~i~~~d~~~a~i~----~ic~l~  258 (264)
                      -+++|.|||--.-||||+|+.|||    ||-||.
T Consensus       138 TLKGL~YLH~~~KIHRDIKAGNILLNT~G~AKLA  171 (502)
T KOG0574|consen  138 TLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLA  171 (502)
T ss_pred             HHhHHHHHHHHHHHHhhcccccEEEcccchhhhh
Confidence            356889999888899999999998    777764


No 438
>KOG1151 consensus Tousled-like protein kinase [Signal transduction mechanisms]
Probab=37.96  E-value=9.5  Score=39.67  Aligned_cols=35  Identities=14%  Similarity=0.125  Sum_probs=27.8

Q ss_pred             cCCCCcchhHHHHHHhhhhccc--cccccCcchhhhH
Q 024658          218 DHGQSVSRSTAIISSLRGLQNQ--TMTDQGDAAAAIT  252 (264)
Q Consensus       218 ~~~~~~s~~t~i~~sl~~l~~~--~i~~~d~~~a~i~  252 (264)
                      +.-++-|-.-+||+.|+||-..  -|||-|.|++|||
T Consensus       566 SEKEARSIiMQiVnAL~YLNEikpPIIHYDLKPgNIL  602 (775)
T KOG1151|consen  566 SEKEARSIIMQIVNALKYLNEIKPPIIHYDLKPGNIL  602 (775)
T ss_pred             hHHHHHHHHHHHHHHHHHHhccCCCeeeeccCCccEE
Confidence            3344555567899999999855  5999999999997


No 439
>KOG1980 consensus Uncharacterized conserved protein [Function unknown]
Probab=36.12  E-value=17  Score=38.67  Aligned_cols=20  Identities=10%  Similarity=-0.158  Sum_probs=14.8

Q ss_pred             CCCCCccccccCCCCccccCC
Q 024658           79 GVNDDDKAVVRGGSQSERISG   99 (264)
Q Consensus        79 ~~H~r~pV~~~~g~p~~~~~~   99 (264)
                      .+-+||| .+|+.-+.+-.-|
T Consensus       360 ~~~~~VP-Kg~S~yqa~wi~d  379 (754)
T KOG1980|consen  360 KRPKRVP-KGTSDYQAAWILD  379 (754)
T ss_pred             ccccccC-CCccccceeeecC
Confidence            5677888 8888888776654


No 440
>KOG0668 consensus Casein kinase II, alpha subunit [Signal transduction mechanisms; Cell cycle control, cell division, chromosome partitioning; Transcription]
Probab=35.83  E-value=20  Score=34.53  Aligned_cols=28  Identities=4%  Similarity=0.024  Sum_probs=25.1

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -+.+|+..|-+-|+..|.|||.|+-|+.
T Consensus       137 Y~~elLkALdyCHS~GImHRDVKPhNvm  164 (338)
T KOG0668|consen  137 YIYELLKALDYCHSMGIMHRDVKPHNVM  164 (338)
T ss_pred             HHHHHHHHHhHHHhcCcccccCCcceee
Confidence            4689999999999999999999998763


No 441
>KOG0597 consensus Serine-threonine protein kinase FUSED [General function prediction only]
Probab=35.60  E-value=17  Score=38.65  Aligned_cols=27  Identities=15%  Similarity=0.190  Sum_probs=24.9

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .-++|..|-|||+-.|.|+|.|+-+||
T Consensus       106 a~~LVsaL~yLhs~rilhrd~kPqniL  132 (808)
T KOG0597|consen  106 AYDLVSALYYLHSNRILHRDMKPQNIL  132 (808)
T ss_pred             HHHHHHHHHHHHhcCcccccCCcceee
Confidence            457899999999999999999999997


No 442
>KOG0772 consensus Uncharacterized conserved protein, contains WD40 repeat [Function unknown]
Probab=34.70  E-value=31  Score=36.14  Aligned_cols=7  Identities=29%  Similarity=0.515  Sum_probs=4.3

Q ss_pred             ceecCCC
Q 024658          134 QVVPWSG  140 (264)
Q Consensus       134 qvVp~s~  140 (264)
                      -.||.+-
T Consensus       153 ~~IP~sh  159 (641)
T KOG0772|consen  153 KLIPGSH  159 (641)
T ss_pred             hcCCccc
Confidence            4578763


No 443
>KOG0587 consensus Traf2- and Nck-interacting kinase and related germinal center kinase (GCK) family protein kinases [Signal transduction mechanisms]
Probab=34.63  E-value=17  Score=39.93  Aligned_cols=26  Identities=15%  Similarity=0.248  Sum_probs=23.8

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..|+-+|.+|||-.+||||+|+-|||
T Consensus       130 re~lrgl~HLH~nkviHRDikG~NiL  155 (953)
T KOG0587|consen  130 REILRGLAHLHNNKVIHRDIKGQNVL  155 (953)
T ss_pred             HHHHHHHHHHhhcceeeecccCceEE
Confidence            56777999999999999999999997


No 444
>PF03660 PHF5:  PHF5-like protein;  InterPro: IPR005345 Phf5 is a member of a novel murine multigene family that is highly conserved during evolution and belongs to the superfamily of PHD-finger proteins. At least one example, from Mus musculus (Mouse), may act as a chromatin-associated protein []. The Schizosaccharomyces pombe (Fission yeast) ini1 gene is essential, required for splicing []. It is localised in the nucleus, but not detected in the nucleolus and can be complemented by human ini1 []. The proteins of this family contain five CXXC motifs.; PDB: 2K0A_A.
Probab=34.57  E-value=17  Score=30.28  Aligned_cols=52  Identities=23%  Similarity=0.392  Sum_probs=25.4

Q ss_pred             cccccccCcccccccccCCcccccccccccccCCCCceecccCCCC-------cccCchhhh
Q 024658           20 ASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPT-------VSVCDACVA   74 (264)
Q Consensus        20 A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~p~~ka~~~C~~d~-------~~LC~~Cd~   74 (264)
                      ..||..||-+--.-...++-...|.+|+-|....   ....|..|.       +..|..|..
T Consensus        20 G~lC~kCdGkCpiCDS~Vrp~~~VrICdeCs~G~---~~~rCIiCg~~~g~sdAYYC~eC~~   78 (106)
T PF03660_consen   20 GRLCEKCDGKCPICDSYVRPCTKVRICDECSFGS---LQGRCIICGSGPGVSDAYYCWECVR   78 (106)
T ss_dssp             -EE-GGGTT--TTT-------EE-EEEHHHHTSS---TTSB-TTTSSSB--EE-EE-HHHHH
T ss_pred             hhhhhhcCCcccccCCccCCcceEEECCcCCCCC---cCceEEEecCCCCcccceehhhhHh
Confidence            3455555554443334444567788999888776   556666666       678888866


No 445
>PRK15123 lipopolysaccharide core heptose(I) kinase RfaP; Provisional
Probab=34.18  E-value=21  Score=32.92  Aligned_cols=26  Identities=4%  Similarity=0.119  Sum_probs=23.5

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+|...+.+||...|+|+|....|||
T Consensus       145 ~~la~~i~~LH~~Gi~HgDL~~~NiL  170 (268)
T PRK15123        145 KRVATMVRDMHAAGINHRDCYICHFL  170 (268)
T ss_pred             HHHHHHHHHHHHCcCccCCCChhhEE
Confidence            46777899999999999999999996


No 446
>KOG4158 consensus BRPK/PTEN-induced protein kinase [Signal transduction mechanisms]
Probab=34.07  E-value=17  Score=37.32  Aligned_cols=26  Identities=8%  Similarity=0.215  Sum_probs=23.9

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .|+++...+||++.|-|||.|+-|||
T Consensus       348 aQlLEav~hL~~hgvAhRDlKSDNiL  373 (598)
T KOG4158|consen  348 AQLLEAVTHLHKHGVAHRDLKSDNIL  373 (598)
T ss_pred             HHHHHHHHHHHHccchhhcccccceE
Confidence            46788999999999999999999997


No 447
>KOG0671 consensus LAMMER dual specificity kinases [Signal transduction mechanisms]
Probab=33.54  E-value=20  Score=35.97  Aligned_cols=27  Identities=15%  Similarity=0.154  Sum_probs=25.3

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..||+.+++.||.-.|||-|.|+-|||
T Consensus       198 ~~QL~~sv~fLh~~kl~HTDLKPENIL  224 (415)
T KOG0671|consen  198 GYQLLESVAFLHDLKLTHTDLKPENIL  224 (415)
T ss_pred             HHHHHHHHHHHHhcceeecCCChheEE
Confidence            468999999999999999999999997


No 448
>PF14531 Kinase-like:  Kinase-like; PDB: 3DZO_A 2W1Z_A 3BYV_A 3Q5Z_A 3Q60_A.
Probab=32.93  E-value=22  Score=33.68  Aligned_cols=28  Identities=7%  Similarity=0.074  Sum_probs=23.8

Q ss_pred             hhHHHHHHhhhhccccccccCcchhhhH
Q 024658          225 RSTAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       225 ~~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      -|-++|.-..+||++.|.|+|+++.++|
T Consensus       150 lT~Q~I~lvA~Lh~~GlVHgdi~~~nfl  177 (288)
T PF14531_consen  150 LTVQMIRLVANLHSYGLVHGDIKPENFL  177 (288)
T ss_dssp             HHHHHHHHHHHHHHTTEEEST-SGGGEE
T ss_pred             HHHHHHHHHHHHhhcceEecccceeeEE
Confidence            3557788889999999999999999987


No 449
>KOG2038 consensus CAATT-binding transcription factor/60S ribosomal subunit biogenesis protein [Translation, ribosomal structure and biogenesis; Transcription]
Probab=32.79  E-value=24  Score=38.53  Aligned_cols=11  Identities=36%  Similarity=1.002  Sum_probs=4.7

Q ss_pred             EEecCCCcccc
Q 024658           13 MYCESDQASLC   23 (264)
Q Consensus        13 vyC~aD~A~LC   23 (264)
                      +||-|+.+.|+
T Consensus       697 ~f~nAd~tslW  707 (988)
T KOG2038|consen  697 LFCNADHTSLW  707 (988)
T ss_pred             cccCCccchHH
Confidence            44444444433


No 450
>PF05764 YL1:  YL1 nuclear protein;  InterPro: IPR008895 The proteins in this family are designated YL1 []. They have been shown to be DNA-binding and may be transcription factors [].; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=32.59  E-value=42  Score=30.71  Aligned_cols=6  Identities=33%  Similarity=0.628  Sum_probs=2.5

Q ss_pred             hhHHHH
Q 024658          225 RSTAII  230 (264)
Q Consensus       225 ~~t~i~  230 (264)
                      |++.|.
T Consensus       145 R~st~~  150 (240)
T PF05764_consen  145 RSSTVA  150 (240)
T ss_pred             HHHHHH
Confidence            444443


No 451
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=32.57  E-value=45  Score=38.27  Aligned_cols=104  Identities=27%  Similarity=0.384  Sum_probs=0.0

Q ss_pred             CCCCccccccCCCCccccCCCCCCCCCC----------------CCCCCCCCCCCCCCCcchhhccccCCceecCCCCCC
Q 024658           80 VNDDDKAVVRGGSQSERISGHDETDDDD----------------DYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDS  143 (264)
Q Consensus        80 ~H~r~pV~~~~g~p~~~~~~~d~~~~dd----------------~~~ded~~~dd~e~e~~~~~ee~~enqvVp~s~~~~  143 (264)
                      ...+-+.....|.+.......-++++||                +|+++|+++-.++.++++++++|..|+.---..++.
T Consensus      1320 ~~~~~~~~~~~~~~~~~~~~e~~~~~ddddas~~k~~~k~~~~~dYe~~de~e~~~~~~~e~~~~~e~~e~d~e~g~dg~ 1399 (1640)
T KOG0262|consen 1320 GNEVDNNDEVGGEDNEDSDDESEDDEDDDDASDAKLHKKTEEEADYESEDEDERVEEREDEGDEDEESDEDDEEVGLDGT 1399 (1640)
T ss_pred             cccCCccccccCCccccccccccccCcccchhHHHHhhhhccccCcCCCchhhhhhhhhcccccccccccchhhcccCCC


Q ss_pred             CCCCCCCCCCCCCCCCccccchhhhhhccc-cCCCCCccccC
Q 024658          144 QSPPQPPPPPVSSSCSSISEEDFSLKRMRD-FGDLFSDDEIG  184 (264)
Q Consensus       144 ~~~~~~~pp~~ssss~~~~~~~~~~kr~r~-~~~~~s~~~~~  184 (264)
                      .+|...+.+..---...+.- -+++|+.++ -.....+.+.|
T Consensus      1400 ~~~~~~~~e~~~~~~~~er~-~qs~~~~~~fi~~y~fd~~~~ 1440 (1640)
T KOG0262|consen 1400 PEPEEEDQEGQPEVNAVERR-EQSVKKRHDFISRYTFDKESG 1440 (1640)
T ss_pred             CCcccccccCCchhhHHHHH-HHHHHHHHHHhhhhccccccC


No 452
>PRK14873 primosome assembly protein PriA; Provisional
Probab=32.38  E-value=31  Score=36.25  Aligned_cols=38  Identities=13%  Similarity=0.307  Sum_probs=26.3

Q ss_pred             CceEEecCCC-cccccccCcccccccccCCcccccccccccccC
Q 024658           10 PARMYCESDQ-ASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSL   52 (264)
Q Consensus        10 pA~vyC~aD~-A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~   52 (264)
                      ...++|+.+. ..-|..||..+-..     +..+.+.|..|...
T Consensus       381 ap~l~C~~Cg~~~~C~~C~~~L~~h-----~~~~~l~Ch~CG~~  419 (665)
T PRK14873        381 VPSLACARCRTPARCRHCTGPLGLP-----SAGGTPRCRWCGRA  419 (665)
T ss_pred             CCeeEhhhCcCeeECCCCCCceeEe-----cCCCeeECCCCcCC
Confidence            3567888875 78899998554321     23457889999764


No 453
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit
Probab=31.59  E-value=46  Score=37.27  Aligned_cols=36  Identities=19%  Similarity=0.271  Sum_probs=26.4

Q ss_pred             cccccccccccccCCC----CceecccCCCCcccCchhhh
Q 024658           39 KHLRCLLCHVCQSLTP----WKASGPKLGPTVSVCDACVA   74 (264)
Q Consensus        39 rH~RvpLC~~C~~~p~----~ka~~~C~~d~~~LC~~Cd~   74 (264)
                      ++.-..+|+.|...-.    --..+.|.+|+-+||..|.-
T Consensus        13 ~~~~~qiCqICGD~vg~~~~Ge~FVAC~eC~FPVCrpCYE   52 (1079)
T PLN02638         13 KHGGGQVCQICGDNVGKTVDGEPFVACDVCAFPVCRPCYE   52 (1079)
T ss_pred             cccCCceeeecccccCcCCCCCEEEEeccCCCccccchhh
Confidence            3444458999975322    22678999999999999986


No 454
>KOG2807 consensus RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription; Replication, recombination and repair]
Probab=31.45  E-value=23  Score=35.06  Aligned_cols=67  Identities=18%  Similarity=0.239  Sum_probs=46.0

Q ss_pred             CceEEecCCCcccc------cccCcccccccccCC-ccccccc----------------ccccccCCCCceecccCCCCc
Q 024658           10 PARMYCESDQASLC------WDCDEKVHCANFLVA-KHLRCLL----------------CHVCQSLTPWKASGPKLGPTV   66 (264)
Q Consensus        10 pA~vyC~aD~A~LC------~~CDa~VHsAN~La~-rH~RvpL----------------C~~C~~~p~~ka~~~C~~d~~   66 (264)
                      -+.++|....|+-|      .-|+..+=++.-|++ -|.=+||                |-+|+..-..+..+.|..|..
T Consensus       274 ~~Gy~CP~CkakvCsLP~eCpiC~ltLVss~hLARSyhhL~PL~~F~Eip~~~~~~~~~Cf~C~~~~~~~~~y~C~~Ck~  353 (378)
T KOG2807|consen  274 GGGYFCPQCKAKVCSLPIECPICSLTLVSSPHLARSYHHLFPLKPFVEIPETEYNGSRFCFACQGELLSSGRYRCESCKN  353 (378)
T ss_pred             cCceeCCcccCeeecCCccCCccceeEecchHHHHHHHhhcCCcchhhccccccCCCcceeeeccccCCCCcEEchhccc
Confidence            47888888888765      457766555444444 2333333                667855444557899999999


Q ss_pred             ccCchhhh-cc
Q 024658           67 SVCDACVA-AA   76 (264)
Q Consensus        67 ~LC~~Cd~-~~   76 (264)
                      .+|..|+. .|
T Consensus       354 ~FCldCDv~iH  364 (378)
T KOG2807|consen  354 VFCLDCDVFIH  364 (378)
T ss_pred             eeeccchHHHH
Confidence            99999999 55


No 455
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=31.41  E-value=50  Score=23.07  Aligned_cols=32  Identities=16%  Similarity=0.249  Sum_probs=24.6

Q ss_pred             cccccccCCCCceecccCCC-CcccCchhhhcc
Q 024658           45 LCHVCQSLTPWKASGPKLGP-TVSVCDACVAAA   76 (264)
Q Consensus        45 LC~~C~~~p~~ka~~~C~~d-~~~LC~~Cd~~~   76 (264)
                      .|..|...+..-.-+.|..| ..-||..|...+
T Consensus         2 ~Cd~C~~~~~~g~r~~C~~C~d~dLC~~Cf~~g   34 (49)
T cd02335           2 HCDYCSKDITGTIRIKCAECPDFDLCLECFSAG   34 (49)
T ss_pred             CCCCcCCCCCCCcEEECCCCCCcchhHHhhhCc
Confidence            37778766644466888888 788999999976


No 456
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=31.37  E-value=43  Score=23.07  Aligned_cols=31  Identities=23%  Similarity=0.415  Sum_probs=23.0

Q ss_pred             cccccccCCCCceecccCCC-CcccCchhhhcc
Q 024658           45 LCHVCQSLTPWKASGPKLGP-TVSVCDACVAAA   76 (264)
Q Consensus        45 LC~~C~~~p~~ka~~~C~~d-~~~LC~~Cd~~~   76 (264)
                      .|..|+. +-.-.-+.|..| ..-||..|...+
T Consensus         2 ~Cd~C~~-~i~G~ry~C~~C~d~dLC~~C~~~~   33 (43)
T cd02340           2 ICDGCQG-PIVGVRYKCLVCPDYDLCESCEAKG   33 (43)
T ss_pred             CCCCCCC-cCcCCeEECCCCCCccchHHhhCcC
Confidence            4677877 434467788888 688999998854


No 457
>KOG0604 consensus MAP kinase-activated protein kinase 2 [Signal transduction mechanisms]
Probab=30.85  E-value=26  Score=34.85  Aligned_cols=26  Identities=12%  Similarity=0.114  Sum_probs=22.6

Q ss_pred             HHHHHHhhhhccccccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      .+|-..+.|||.-.|-|||.|+-|+|
T Consensus       168 ~qI~~Av~~lH~~nIAHRDlKpENLL  193 (400)
T KOG0604|consen  168 KQIGLAVRYLHSMNIAHRDLKPENLL  193 (400)
T ss_pred             HHHHHHHHHHHhcchhhccCChhhee
Confidence            44555789999999999999999987


No 458
>PF09073 BUD22:  BUD22;  InterPro: IPR015158 BUD22 has been shown in yeast to be a nuclear protein involved in bud-site selection. It plays a role in positioning the proximal bud pole signal []. 
Probab=30.07  E-value=72  Score=31.53  Aligned_cols=71  Identities=24%  Similarity=0.406  Sum_probs=0.0

Q ss_pred             CccccCCCCCCCCCCCCCCCCCCCCCCCCCc------------chhhccccCCceecCCCCCCCCCCCCCCCCCCCCCCc
Q 024658           93 QSERISGHDETDDDDDYEDEDDDDDDDEDPD------------EEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSS  160 (264)
Q Consensus        93 p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~------------~~~~ee~~enqvVp~s~~~~~~~~~~~pp~~ssss~~  160 (264)
                      ....++......+++++++++++.+++.|++            ++|+++++++.++......+.+......-..|.+.+.
T Consensus       177 ~~~~~~~d~~~~e~~~~~~~~~~~~~~~d~~~~~q~d~~l~~Ssdee~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~s~  256 (432)
T PF09073_consen  177 EESEEGEDSSDDESDEEDDEEDDEDEESDDEDLSQYDGLLASSSDEESEDEDDPSIDEDESESESEEDDEDESDSDSDSP  256 (432)
T ss_pred             ccccccccccccccccccccccccccccchhhhhhhhccccCCccccccccccccCCccccccccccccccccccccccc


Q ss_pred             ccc
Q 024658          161 ISE  163 (264)
Q Consensus       161 ~~~  163 (264)
                      ..+
T Consensus       257 s~s  259 (432)
T PF09073_consen  257 SDS  259 (432)
T ss_pred             ccc


No 459
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=29.87  E-value=47  Score=23.63  Aligned_cols=41  Identities=15%  Similarity=0.086  Sum_probs=0.0

Q ss_pred             ccccccCCCCceecccCCCC---cccCchhhhcc--cCCCCCCccc
Q 024658           46 CHVCQSLTPWKASGPKLGPT---VSVCDACVAAA--RCGVNDDDKA   86 (264)
Q Consensus        46 C~~C~~~p~~ka~~~C~~d~---~~LC~~Cd~~~--n~~~H~r~pV   86 (264)
                      |..|...|-.-.-+.|..|.   .-||..|...+  ....|.-++|
T Consensus         3 Cd~C~~~pI~G~R~~C~~C~~~d~DlC~~C~~~~~~H~~~H~~~~i   48 (48)
T cd02341           3 CDSCGIEPIPGTRYHCSECDDGDFDLCQDCVVKGESHQEDHWLVKI   48 (48)
T ss_pred             CCCCCCCccccceEECCCCCCCCCccCHHHHhCcCCCCCCCceeeC


No 460
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=29.85  E-value=51  Score=22.54  Aligned_cols=44  Identities=16%  Similarity=0.196  Sum_probs=0.0

Q ss_pred             ccccccccCCCCceecccCCCC-cccCchhhhcccCCCCC-Ccccccc
Q 024658           44 LLCHVCQSLTPWKASGPKLGPT-VSVCDACVAAARCGVND-DDKAVVR   89 (264)
Q Consensus        44 pLC~~C~~~p~~ka~~~C~~d~-~~LC~~Cd~~~n~~~H~-r~pV~~~   89 (264)
                      ..|..|.. +-+-.-+.|..|. .-||..|...+. +.|. ..+..++
T Consensus         1 ~~C~~C~~-~i~g~r~~C~~C~d~dLC~~Cf~~~~-~~H~~~H~~~~~   46 (46)
T cd02249           1 YSCDGCLK-PIVGVRYHCLVCEDFDLCSSCYAKGK-KGHPPDHSFTEI   46 (46)
T ss_pred             CCCcCCCC-CCcCCEEECCCCCCCcCHHHHHCcCc-CCCCCCCCEeEC


No 461
>KOG1834 consensus Calsyntenin [Extracellular structures]
Probab=29.74  E-value=32  Score=37.08  Aligned_cols=40  Identities=28%  Similarity=0.582  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCcchhhccccCCceec
Q 024658           98 SGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVP  137 (264)
Q Consensus        98 ~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp  137 (264)
                      ...+++++..++++||+.+.++-+++|.+++||++..-|+
T Consensus       892 s~ee~~e~EeeeE~e~~ee~s~~~~~ds~sedEee~~e~~  931 (952)
T KOG1834|consen  892 SIEEESEEEEEEETEDEEESSDSDSADSESEDEEEGTEVG  931 (952)
T ss_pred             cccccccccccccccccccccccccccCccchhhhccccC


No 462
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=29.08  E-value=23  Score=22.98  Aligned_cols=24  Identities=25%  Similarity=0.315  Sum_probs=0.0

Q ss_pred             ccccccccccCCCCceecccCCCCcccC
Q 024658           42 RCLLCHVCQSLTPWKASGPKLGPTVSVC   69 (264)
Q Consensus        42 RvpLC~~C~~~p~~ka~~~C~~d~~~LC   69 (264)
                      +..+|.+|.. +   +.+.|..|.+.+|
T Consensus         1 ~~~~C~vC~~-~---~kY~Cp~C~~~~C   24 (30)
T PF04438_consen    1 PRKLCSVCGN-P---AKYRCPRCGARYC   24 (30)
T ss_dssp             --EEETSSSS-E---ESEE-TTT--EES
T ss_pred             CcCCCccCcC-C---CEEECCCcCCcee


No 463
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=28.87  E-value=27  Score=36.72  Aligned_cols=32  Identities=28%  Similarity=0.628  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCcchhhccccC
Q 024658          101 DETDDDDDYEDEDDDDDDDEDPDEEEEEEDDE  132 (264)
Q Consensus       101 d~~~~dd~~~ded~~~dd~e~e~~~~~ee~~e  132 (264)
                      .+|.|++..+|+++|.|+++-|+|.+++|+.+
T Consensus       215 ~eEed~e~~~d~~~~~~~Ed~e~d~edeEe~D  246 (678)
T KOG0127|consen  215 KEEEDKEADEDDGKDFDEEDGEEDSEDEEETD  246 (678)
T ss_pred             chhhhcccccccccccchhccccccccccccc


No 464
>KOG4672 consensus Uncharacterized conserved low complexity protein [Function unknown]
Probab=28.79  E-value=92  Score=31.86  Aligned_cols=68  Identities=19%  Similarity=0.223  Sum_probs=0.0

Q ss_pred             ccCCCCccccCCCCCCCCCCCCCCCCCC----------------CCCCCCCcchhhccccCCceecCCCCCCCCCCCCCC
Q 024658           88 VRGGSQSERISGHDETDDDDDYEDEDDD----------------DDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPP  151 (264)
Q Consensus        88 ~~~g~p~~~~~~~d~~~~dd~~~ded~~----------------~dd~e~e~~~~~ee~~enqvVp~s~~~~~~~~~~~p  151 (264)
                      .+-+...+-+|.-.+.+.|..+|.-|+.                .++++++++++.+||+-...++-+-++....|++++
T Consensus       231 d~~ss~~ed~g~pe~~~~dkh~ds~d~a~~~~i~e~~~~v~~~~~~~~~d~~dds~~eden~~~~~~sn~sk~a~P~~~a  310 (487)
T KOG4672|consen  231 DGLSSNFEDSGEPEEEGHDKHYDSIDLAPDNRINENITSVPLLPPPGIPDNEDDSRPEDENASSFQNSNLSKTAIPEPDA  310 (487)
T ss_pred             ccccCCCCCCCCccccccccccccccccchhccccccccccccCCCCCCccccccchhhhccccccccccccccCCCCCC


Q ss_pred             CCCC
Q 024658          152 PPVS  155 (264)
Q Consensus       152 p~~s  155 (264)
                      |..+
T Consensus       311 P~~~  314 (487)
T KOG4672|consen  311 PLQP  314 (487)
T ss_pred             Cccc


No 465
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=28.71  E-value=50  Score=35.74  Aligned_cols=75  Identities=23%  Similarity=0.323  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCcchhhccccCCceecCCCCCCCCCCCCCCCCCCCCC---------Cccccchhhh
Q 024658           98 SGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSC---------SSISEEDFSL  168 (264)
Q Consensus        98 ~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp~s~~~~~~~~~~~pp~~ssss---------~~~~~~~~~~  168 (264)
                      |+.++.++.++..-.|+++.+++++++++..-+.+|-.+.-+.+--..+|--.++..++|.         =+.++.+..|
T Consensus       237 gs~~~~e~e~e~~~~de~~e~~~~~~d~d~i~E~~~~~i~~s~~~~~~e~~~~~~~~s~sKYvPPslRkkl~~~~~sE~l  316 (822)
T KOG2141|consen  237 GSEDEDESEDEKDSVDEEEESEEDNEDDDGISEISNSEIRDSALKKSEEPEYLRKINSSSKYVPPSLRKKLETSSESEQL  316 (822)
T ss_pred             cCcccchhhhhccchhhhhhhhhcccCCccccccccccccCCccccCCCcccccccccccccCCHHHHHHhcCccchHHH


Q ss_pred             hhcc
Q 024658          169 KRMR  172 (264)
Q Consensus       169 kr~r  172 (264)
                      -|+|
T Consensus       317 ~rl~  320 (822)
T KOG2141|consen  317 QRLR  320 (822)
T ss_pred             HHHH


No 466
>KOG4364 consensus Chromatin assembly factor-I [Chromatin structure and dynamics]
Probab=28.67  E-value=53  Score=35.33  Aligned_cols=55  Identities=24%  Similarity=0.284  Sum_probs=0.0

Q ss_pred             CCccccccCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCcchhhccccCCceec
Q 024658           82 DDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVP  137 (264)
Q Consensus        82 ~r~pV~~~~g~p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp  137 (264)
                      .|.|+.--.+..+.++.+.+=|++.- .+.=-+++||++++.+++-+|+.+.-.||
T Consensus       507 arrPlAq~~llDYEVdSDeEWEEEep-GESlS~sEddedd~~eEd~edEdDgffVP  561 (811)
T KOG4364|consen  507 ARRPLAQDPLLDYEVDSDEEWEEEEP-GESLSDSEDDEDDSLEEDCEDEDDGFFVP  561 (811)
T ss_pred             cCCcccccccccccccCcccccccCC-CccccccccccccccccccccccCCeecC


No 467
>KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms]
Probab=28.46  E-value=26  Score=38.82  Aligned_cols=27  Identities=19%  Similarity=0.234  Sum_probs=0.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ..||-++++|||.|.++|||.|.-|+|
T Consensus       804 ~~QIAkgM~YLe~qrlVHrdLaaRNVL  830 (1177)
T KOG1025|consen  804 CYQIAKGMKYLEEQRLVHRDLAARNVL  830 (1177)
T ss_pred             HHHHHHHHHHHHhcchhhhhhhhhhee


No 468
>KOG1824 consensus TATA-binding protein-interacting protein [General function prediction only]
Probab=28.12  E-value=26  Score=39.05  Aligned_cols=26  Identities=42%  Similarity=0.722  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCC--CCCCcchh
Q 024658          101 DETDDDDDYEDEDDDDDD--DEDPDEEE  126 (264)
Q Consensus       101 d~~~~dd~~~ded~~~dd--~e~e~~~~  126 (264)
                      |.++|+|...-||++||+  +|.+||||
T Consensus       316 d~~eDed~~~~ed~eDde~~deYsDDeD  343 (1233)
T KOG1824|consen  316 DTEEDEDAMFLEDEEDDEQDDEYSDDED  343 (1233)
T ss_pred             CCccchhhhhhhccccchhccccccccc


No 469
>KOG0590 consensus Checkpoint kinase and related serine/threonine protein kinases [Cell cycle control, cell division, chromosome partitioning]
Probab=27.71  E-value=25  Score=36.27  Aligned_cols=25  Identities=4%  Similarity=0.150  Sum_probs=0.0

Q ss_pred             HHHHHhhhhccccccccCcchhhhH
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +|+.+++|||...|.|||.|.-+|+
T Consensus       428 qL~~Gv~y~h~~GiahrdlK~enll  452 (601)
T KOG0590|consen  428 QLLRGVKYLHSMGLAHRDLKLENLL  452 (601)
T ss_pred             HHHHHHHHHHhcCceeccCccccEE


No 470
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=27.56  E-value=1.1e+02  Score=25.20  Aligned_cols=83  Identities=27%  Similarity=0.379  Sum_probs=0.0

Q ss_pred             cccccCCCCceecccCCCCcccCchhhhcccCC-CCCCccccccCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCcch
Q 024658           47 HVCQSLTPWKASGPKLGPTVSVCDACVAAARCG-VNDDDKAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEE  125 (264)
Q Consensus        47 ~~C~~~p~~ka~~~C~~d~~~LC~~Cd~~~n~~-~H~r~pV~~~~g~p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~~~  125 (264)
                      ..|+.-.   +.||=+.=.-.+|..|-..-... ......+.++...+.+.+........+....++++++.+.+++..+
T Consensus        10 R~Cp~CG---~kFYDLnk~PivCP~CG~~~~~~~~~k~r~~~~~~~~~~~~~~~~~~~~~d~~~~dd~~~~~~~dDd~~d   86 (108)
T PF09538_consen   10 RTCPSCG---AKFYDLNKDPIVCPKCGTEFPPEPPLKSRRPRPDEEEAAADEEEEDEEEDDDVSLDDDDDDDDDDDDLDD   86 (108)
T ss_pred             ccCCCCc---chhccCCCCCccCCCCCCccCccccccccccccccccccccccccccccccccccccccccccccccccc


Q ss_pred             hhccccC
Q 024658          126 EEEEDDE  132 (264)
Q Consensus       126 ~~ee~~e  132 (264)
                      .++++.+
T Consensus        87 ~~dd~~d   93 (108)
T PF09538_consen   87 DDDDDVD   93 (108)
T ss_pred             ccccccc


No 471
>PF15449 Retinal:  Retinal protein
Probab=27.01  E-value=61  Score=36.63  Aligned_cols=58  Identities=29%  Similarity=0.459  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCcchhhccccCCceecCCCCCCCCCCCCCCCCCCCCCCccccchhhhhhccc
Q 024658          110 EDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPVSSSCSSISEEDFSLKRMRD  173 (264)
Q Consensus       110 ~ded~~~dd~e~e~~~~~ee~~enqvVp~s~~~~~~~~~~~pp~~ssss~~~~~~~~~~kr~r~  173 (264)
                      +.-..+++||.+.+|+||+|.+-....+|.-      .+.++-+-||-...++--....||+|.
T Consensus       483 ~~ps~~e~eDss~eEeeede~~s~s~~~~q~------~a~~~RP~SSPa~~es~fq~~~krl~s  540 (1287)
T PF15449_consen  483 DTPSLSEDEDSSPEEEEEDEVSSMSLCTWQE------KALPSRPRSSPAGTESPFQPHSKRLRS  540 (1287)
T ss_pred             CCccccccCCCChhhcccccccccccccccc------ccCCCCCCCCCcccccccccchhhccC


No 472
>PHA02811 putative host range protein; Provisional
Probab=26.87  E-value=39  Score=30.91  Aligned_cols=29  Identities=45%  Similarity=0.724  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCcchhhcc
Q 024658          101 DETDDDDDYEDEDDDDDDDEDPDEEEEEE  129 (264)
Q Consensus       101 d~~~~dd~~~ded~~~dd~e~e~~~~~ee  129 (264)
                      +..++|++++++++++++||..+++++-|
T Consensus       169 ~~~~~d~d~d~~~~~~~~d~~~~~~~~~~  197 (197)
T PHA02811        169 ISSDDDDDNDNADNDEEDDEVNDIEDDYE  197 (197)
T ss_pred             eccccccccccccccccccccccccccCC


No 473
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=26.44  E-value=49  Score=32.67  Aligned_cols=42  Identities=31%  Similarity=0.530  Sum_probs=0.0

Q ss_pred             CCCccccCCCCCCCCCCCCCCCCCCCCCCCCCc--chhhccccC
Q 024658           91 GSQSERISGHDETDDDDDYEDEDDDDDDDEDPD--EEEEEEDDE  132 (264)
Q Consensus        91 g~p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~--~~~~ee~~e  132 (264)
                      |.-..++.+.+|+++++...++|++.+.++++|  |+|.-+.++
T Consensus       255 g~~~~~eE~e~Eee~~~~~~~~dee~~n~Dd~D~~Eeeplnsed  298 (348)
T KOG2652|consen  255 GTGDTSEEDENEEEDDDPDPDEDEELGNSDDDDGVEEEPLNSED  298 (348)
T ss_pred             ccccccccccccccccCcccchhhhcccccccCccccccccCcc


No 474
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification]
Probab=26.34  E-value=36  Score=35.87  Aligned_cols=40  Identities=33%  Similarity=0.597  Sum_probs=0.0

Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCC--CCCCcchhhccccCCce
Q 024658           96 RISGHDETDDDDDYEDEDDDDDD--DEDPDEEEEEEDDENQV  135 (264)
Q Consensus        96 ~~~~~d~~~~dd~~~ded~~~dd--~e~e~~~~~ee~~enqv  135 (264)
                      .+.|+|...+|-++++||+++.|  .|..++.+++|+++-+|
T Consensus       224 ~d~~~~~~~Ed~e~d~edeEe~D~~se~~ee~~~~Eee~~~v  265 (678)
T KOG0127|consen  224 EDDGKDFDEEDGEEDSEDEEETDGNSEAFEEGEESEEEEDDV  265 (678)
T ss_pred             cccccccchhcccccccccccccccchhhhcccccccccccc


No 475
>PF12253 CAF1A:  Chromatin assembly factor 1 subunit A;  InterPro: IPR022043  The CAF-1 or chromatin assembly factor-1 consists of three subunits, and this is the first, or A []. The A domain is uniquely required for the progression of S phase in mouse cells [], independent of its ability to promote histone deposition [] but dependent on its ability to interact with HP1 - heterochromatin protein 1-rich heterochromatin domains next to centromeres that are crucial for chromosome segregation during mitosis. This HP1-CAF-1 interaction module functions as a built-in replication control for heterochromatin, which, like a control barrier, has an impact on S-phase progression in addition to DNA-based checkpoints []. 
Probab=26.09  E-value=77  Score=24.83  Aligned_cols=47  Identities=6%  Similarity=0.263  Sum_probs=0.0

Q ss_pred             Ccccccc-CCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCcchhhcc
Q 024658           83 DDKAVVR-GGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEE  129 (264)
Q Consensus        83 r~pV~~~-~g~p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee  129 (264)
                      |.|+.-- .+--...+.+.+=+++++-++-+++++++++++++++.++
T Consensus        29 r~P~~~d~~~lDYdyDSd~EWeE~e~GEdl~~~eeeeed~e~d~d~D~   76 (77)
T PF12253_consen   29 RNPFAKDLPNLDYDYDSDDEWEEEEEGEDLDSDEEEEEDEEDDDDMDG   76 (77)
T ss_pred             CCcccccccccceecCCccccccCCCCccccccccccccccccccccC


No 476
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=25.93  E-value=37  Score=24.78  Aligned_cols=31  Identities=19%  Similarity=0.198  Sum_probs=0.0

Q ss_pred             ccccccCCCCc-------eecccCCCCcccCchhhh-cc
Q 024658           46 CHVCQSLTPWK-------ASGPKLGPTVSVCDACVA-AA   76 (264)
Q Consensus        46 C~~C~~~p~~k-------a~~~C~~d~~~LC~~Cd~-~~   76 (264)
                      |-.|...-+..       ..+.|..|...+|..|++ +|
T Consensus         2 CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fiH   40 (51)
T PF07975_consen    2 CFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFIH   40 (51)
T ss_dssp             ETTTTEE-TTS-------EEE--TTTT--B-HHHHHTTT
T ss_pred             CccCCCCCCCcccccccCCeEECCCCCCccccCcChhhh


No 477
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=25.40  E-value=64  Score=31.90  Aligned_cols=51  Identities=27%  Similarity=0.416  Sum_probs=0.0

Q ss_pred             ccccCCCCccccCCCCCCCCCCCCCCCCCCCCCCC--CCcchhhccccC---Ccee
Q 024658           86 AVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDE--DPDEEEEEEDDE---NQVV  136 (264)
Q Consensus        86 V~~~~g~p~~~~~~~d~~~~dd~~~ded~~~dd~e--~e~~~~~ee~~e---nqvV  136 (264)
                      |.++.+.-++.+...++.+++.++++|-...|+|+  ||+.-++|+|.-   |-||
T Consensus       253 ~Dg~~~~~eE~e~Eee~~~~~~~~dee~~n~Dd~D~~EeeplnsedDvsdt~nvVv  308 (348)
T KOG2652|consen  253 VDGTGDTSEEDENEEEDDDPDPDEDEELGNSDDDDGVEEEPLNSEDDVSDTQNVVV  308 (348)
T ss_pred             ccccccccccccccccccCcccchhhhcccccccCccccccccCcccccccceeEE


No 478
>PF15243 ANAPC15:  Anaphase-promoting complex subunit 15
Probab=25.22  E-value=41  Score=27.30  Aligned_cols=28  Identities=25%  Similarity=0.712  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCcchhhccccC
Q 024658          105 DDDDYEDEDDDDDDDEDPDEEEEEEDDE  132 (264)
Q Consensus       105 ~dd~~~ded~~~dd~e~e~~~~~ee~~e  132 (264)
                      ++.+.++++++++.++.|+.+++++|-+
T Consensus        63 ~~~e~d~e~~~dd~d~~e~~~~d~de~~   90 (92)
T PF15243_consen   63 EEEEEDDEDEDDDSDDSEESMQDDDEMN   90 (92)
T ss_pred             ccccccccccccccccccchhccchhcc


No 479
>PF14951 DUF4503:  Domain of unknown function (DUF4503)
Probab=25.01  E-value=52  Score=32.93  Aligned_cols=54  Identities=24%  Similarity=0.347  Sum_probs=0.0

Q ss_pred             CCCCCCCC-CceEEecCCCcccccccCcccccccccCCcccccccccccccCCCCceec
Q 024658            2 RKCELCEC-PARMYCESDQASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASG   59 (264)
Q Consensus         2 ~~Cd~C~~-pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~p~~ka~~   59 (264)
                      |.|+.|+. .-...=..-.++.|..|..-|-  ++++++|--|-|-  |+..|...+.+
T Consensus       275 PvCd~CGn~rLe~~pe~rg~~~C~~Cs~~V~--sP~~r~~LeVfl~--Cps~p~ctvKV  329 (389)
T PF14951_consen  275 PVCDRCGNGRLEQSPEDRGAFSCGDCSRVVT--SPVLRMHLEVFLD--CPSRPQCTVKV  329 (389)
T ss_pred             ccccccCCccceeCccCCCceeccchhhhcc--CcceeeeEEEEEe--CCCCCCceEEE


No 480
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=24.95  E-value=55  Score=32.96  Aligned_cols=47  Identities=23%  Similarity=0.357  Sum_probs=0.0

Q ss_pred             eEEecCCC-cccccccCcccccccccCCcccccccccccccCCCCceecccCCCC
Q 024658           12 RMYCESDQ-ASLCWDCDEKVHCANFLVAKHLRCLLCHVCQSLTPWKASGPKLGPT   65 (264)
Q Consensus        12 ~vyC~aD~-A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~~~p~~ka~~~C~~d~   65 (264)
                      .++|+.+. ..-|..||..+-..     ++.+.+.|..|....+  ..-.|+.|.
T Consensus       213 ~~~C~~Cg~~~~C~~C~~~l~~h-----~~~~~l~Ch~Cg~~~~--~~~~Cp~C~  260 (505)
T TIGR00595       213 NLLCRSCGYILCCPNCDVSLTYH-----KKEGKLRCHYCGYQEP--IPKTCPQCG  260 (505)
T ss_pred             eeEhhhCcCccCCCCCCCceEEe-----cCCCeEEcCCCcCcCC--CCCCCCCCC


No 481
>PF05320 Pox_RNA_Pol_19:  Poxvirus DNA-directed RNA polymerase 19 kDa subunit;  InterPro: IPR007984 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. The poxvirus DNA-directed RNA polymerase (2.7.7.6 from EC) catalyses the transcription of DNA into RNA. It consists of at least eight subunits, this is the 19 kDa subunit.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=24.89  E-value=21  Score=31.90  Aligned_cols=30  Identities=50%  Similarity=0.683  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCCcchhhccccC
Q 024658          103 TDDDDDYEDEDDDDDDDEDPDEEEEEEDDE  132 (264)
Q Consensus       103 ~~~dd~~~ded~~~dd~e~e~~~~~ee~~e  132 (264)
                      ++.+|..+.+.|++++++.|++++++++.+
T Consensus         2 ~ds~di~~~~sde~~~~~yee~~e~~~~~e   31 (167)
T PF05320_consen    2 EDSDDIIDYESDEDDIEEYEEEEEDEEDAE   31 (167)
T ss_pred             cchHHHHhhhccCcchhhhhhhcccccccc


No 482
>KOG0262 consensus RNA polymerase I, large subunit [Transcription]
Probab=24.30  E-value=65  Score=37.07  Aligned_cols=52  Identities=31%  Similarity=0.571  Sum_probs=0.0

Q ss_pred             ccccccCCCCccccCCCCCCCCCCCCCCCCCC------------------CCCCCCCcchhhccccCCce
Q 024658           84 DKAVVRGGSQSERISGHDETDDDDDYEDEDDD------------------DDDDEDPDEEEEEEDDENQV  135 (264)
Q Consensus        84 ~pV~~~~g~p~~~~~~~d~~~~dd~~~ded~~------------------~dd~e~e~~~~~ee~~enqv  135 (264)
                      .|..+-.+......+|.+++++|++.++|.+|                  |++||+|..++.+++++++.
T Consensus      1316 ~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~ddddas~~k~~~k~~~~~dYe~~de~e~~~~~~~e~~~~~ 1385 (1640)
T KOG0262|consen 1316 DPDDGNEVDNNDEVGGEDNEDSDDESEDDEDDDDASDAKLHKKTEEEADYESEDEDERVEEREDEGDEDE 1385 (1640)
T ss_pred             CccccccCCccccccCCccccccccccccCcccchhHHHHhhhhccccCcCCCchhhhhhhhhccccccc


No 483
>KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms]
Probab=24.18  E-value=30  Score=37.44  Aligned_cols=25  Identities=24%  Similarity=0.255  Sum_probs=0.0

Q ss_pred             HHHHHhhhhccccccccCcchhhhH
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +|-++|.|||++...|||+|.-|||
T Consensus       499 Qi~talaYLeSkrfVHRDIAaRNiL  523 (974)
T KOG4257|consen  499 QICTALAYLESKRFVHRDIAARNIL  523 (974)
T ss_pred             HHHHHHHHHHhhchhhhhhhhhhee


No 484
>KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms]
Probab=24.17  E-value=36  Score=36.31  Aligned_cols=27  Identities=7%  Similarity=0.103  Sum_probs=0.0

Q ss_pred             hHHHHHHhhhhccccccccCcchhhhH
Q 024658          226 STAIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       226 ~t~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      ...|+-+|.+||...||.||.|=-|||
T Consensus       474 aAev~l~L~fLH~~~IIYRDlKLdNiL  500 (694)
T KOG0694|consen  474 AAEVVLGLQFLHENGIIYRDLKLDNLL  500 (694)
T ss_pred             HHHHHHHHHHHHhcCceeeecchhheE


No 485
>KOG1240 consensus Protein kinase containing WD40 repeats [Signal transduction mechanisms]
Probab=24.01  E-value=34  Score=38.99  Aligned_cols=25  Identities=8%  Similarity=0.097  Sum_probs=0.0

Q ss_pred             HHHHHhhhhccccccccCcchhhhH
Q 024658          228 AIISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       228 ~i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +|+.+|+..|++.|-|||+|.-|||
T Consensus       128 QLL~al~qcH~~gVcHGDIKsENIL  152 (1431)
T KOG1240|consen  128 QLLKALSQCHKLGVCHGDIKSENIL  152 (1431)
T ss_pred             HHHHHHHHHHHcCccccccccceEE


No 486
>KOG1834 consensus Calsyntenin [Extracellular structures]
Probab=23.94  E-value=52  Score=35.58  Aligned_cols=44  Identities=20%  Similarity=0.353  Sum_probs=0.0

Q ss_pred             cccccCCCCccccCCCCCCCCCCCCCCCCCCCCCCCCCcchhhcc
Q 024658           85 KAVVRGGSQSERISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEE  129 (264)
Q Consensus        85 pV~~~~g~p~~~~~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee  129 (264)
                      |+.-|-+ +.+.+.+.++|++.+.++.+..+|.+.+|.+.+|||+
T Consensus       883 Pme~~e~-~gs~ee~~e~EeeeE~e~~ee~s~~~~~ds~sedEee  926 (952)
T KOG1834|consen  883 PMEDYEK-GGSIEEESEEEEEEETEDEEESSDSDSADSESEDEEE  926 (952)
T ss_pred             chHhccc-CCcccccccccccccccccccccccccccCccchhhh


No 487
>PF03896 TRAP_alpha:  Translocon-associated protein (TRAP), alpha subunit;  InterPro: IPR005595  The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane [].; GO: 0005783 endoplasmic reticulum
Probab=23.74  E-value=63  Score=30.80  Aligned_cols=50  Identities=30%  Similarity=0.509  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCcchhhccccCCceecCCCCCCCCCCCCCCCCC
Q 024658          105 DDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPPV  154 (264)
Q Consensus       105 ~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp~s~~~~~~~~~~~pp~~  154 (264)
                      .|..++++.+++..++|++|+.+.++++.+..+-..+.+...+..+-|-+
T Consensus        33 ~~~~~d~e~~~~~~~~e~~d~~~~~ed~~~~~e~~dd~~e~~~~~~sP~a   82 (285)
T PF03896_consen   33 QDDTEDEEVEDDEVEEEEEDEAEVEEDESIETEVEDDDEEDGELKPSPDA   82 (285)
T ss_pred             ccccccchhhhccccccccccceecccCCCCCcccccccccccccccCCc


No 488
>KOG2141 consensus Protein involved in high osmolarity signaling pathway [Signal transduction mechanisms]
Probab=23.61  E-value=76  Score=34.47  Aligned_cols=63  Identities=29%  Similarity=0.446  Sum_probs=0.0

Q ss_pred             CCCccccCCCCCCC--CCCCCCCCCCCCCCCCCCcchhhccccCCceecCCCCCCCCCCCCCCCC
Q 024658           91 GSQSERISGHDETD--DDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPWSGDDSQSPPQPPPPP  153 (264)
Q Consensus        91 g~p~~~~~~~d~~~--~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp~s~~~~~~~~~~~pp~  153 (264)
                      +.-+.++.|+++++  ..|+.+++|+-...||++++++++++.+.-+=+--+.-+++++-+.+++
T Consensus       222 e~~e~~e~~~~~~~sgs~~~~e~e~e~~~~de~~e~~~~~~d~d~i~E~~~~~i~~s~~~~~~e~  286 (822)
T KOG2141|consen  222 EESEDSESGDEEDDSGSEDEDESEDEKDSVDEEEESEEDNEDDDGISEISNSEIRDSALKKSEEP  286 (822)
T ss_pred             ccccccccccccccccCcccchhhhhccchhhhhhhhhcccCCccccccccccccCCccccCCCc


No 489
>smart00750 KIND kinase non-catalytic C-lobe domain. It is an interaction domain identified as being similar to the C-terminal protein kinase catalytic fold (C lobe). Its presence at the N terminus of signalling proteins and the absence of the active-site residues in the catalytic and activation loops suggest that it folds independently and is likely to be non-catalytic. The occurrence of KIND only in metazoa implies that it has evolved from the catalytic protein kinase domain into an interaction domain possibly by keeping the substrate-binding features
Probab=23.45  E-value=42  Score=26.76  Aligned_cols=37  Identities=16%  Similarity=0.204  Sum_probs=0.0

Q ss_pred             HHHHHHhhhhcc----ccccccCcchhhhHhhhhccccccC
Q 024658          227 TAIISSLRGLQN----QTMTDQGDAAAAITGICRLSRDHQT  263 (264)
Q Consensus       227 t~i~~sl~~l~~----~~i~~~d~~~a~i~~ic~l~~~~~~  263 (264)
                      .+|+.+|.+||+    .-|.-.++....++|++++......
T Consensus        24 ~qi~~~L~~lH~~~kp~Nil~~~~~~~~~fG~~~~~~~~~~   64 (176)
T smart00750       24 LQCLRALRELHRQAKSGNILLTWDGLLKLDGSVAFKTPEQS   64 (176)
T ss_pred             HHHHHHHHHHHhcCCcccEeEcCccceeeccceEeeccccC


No 490
>KOG2773 consensus Apoptosis antagonizing transcription factor/protein transport protein [Transcription; Intracellular trafficking, secretion, and vesicular transport]
Probab=22.91  E-value=47  Score=34.04  Aligned_cols=38  Identities=39%  Similarity=0.726  Sum_probs=0.0

Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCCCCCCcchhhccccCC
Q 024658           96 RISGHDETDDDDDYEDEDDDDDDDEDPDEEEEEEDDEN  133 (264)
Q Consensus        96 ~~~~~d~~~~dd~~~ded~~~dd~e~e~~~~~ee~~en  133 (264)
                      .++++++..+.+++.+..+++..+++|++++++++.+|
T Consensus        79 ~e~~~~~~~~~~~~~e~eE~~~~~~~Es~Ee~~eed~n  116 (483)
T KOG2773|consen   79 EEGKGDEKSEEDDEEESEEENEGDEEESDEEEEEEDEN  116 (483)
T ss_pred             cccccccccccccccccccccccccccccccchhhhcc


No 491
>KOG1991 consensus Nuclear transport receptor RANBP7/RANBP8 (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]
Probab=22.81  E-value=50  Score=36.66  Aligned_cols=43  Identities=26%  Similarity=0.340  Sum_probs=0.0

Q ss_pred             cCCCCccccCCCCCCCCCCCCCCCCCC--------------------CCCCCCCcchhhcccc
Q 024658           89 RGGSQSERISGHDETDDDDDYEDEDDD--------------------DDDDEDPDEEEEEEDD  131 (264)
Q Consensus        89 ~~g~p~~~~~~~d~~~~dd~~~ded~~--------------------~dd~e~e~~~~~ee~~  131 (264)
                      +++.....++..+|+..+|++|++.++                    +||.++++.+.+|+++
T Consensus       888 ~~~e~~~~~~~~~e~~~~d~dD~d~~d~d~~~~~~~~~~~~~~~~~~ddd~d~~~~~~~ed~~  950 (1010)
T KOG1991|consen  888 DSEEGEEEDDDEEEDFIDDEDDIDEDDQDYLDEYGELALEKEDSLDDDDDFDEDELDLEEDEL  950 (1010)
T ss_pred             ccccccCCCCcchhhccCccccccccchhHHHhhccccccccccccccccccchhcccccccc


No 492
>PLN02915 cellulose synthase A [UDP-forming], catalytic subunit
Probab=22.80  E-value=71  Score=35.76  Aligned_cols=71  Identities=23%  Similarity=0.255  Sum_probs=0.0

Q ss_pred             cccccccCCCCc----eecccCCCCcccCchhhhcccCCCCCCccccccCCCCcccc-CCCCCCCCCCCCCCCCCCCCC
Q 024658           45 LCHVCQSLTPWK----ASGPKLGPTVSVCDACVAAARCGVNDDDKAVVRGGSQSERI-SGHDETDDDDDYEDEDDDDDD  118 (264)
Q Consensus        45 LC~~C~~~p~~k----a~~~C~~d~~~LC~~Cd~~~n~~~H~r~pV~~~~g~p~~~~-~~~d~~~~dd~~~ded~~~dd  118 (264)
                      +|+.|...-...    ..+.|..|+-++|..|.---...+.+-.|-   .+.+..+- |..--+.||+++++.||.+++
T Consensus        17 ~c~iCGd~vg~~~~Ge~FVAC~eC~fpvCr~cyeye~~~g~~~cp~---c~t~y~~~~~~~~~~~d~~~~~~~dd~~~~   92 (1044)
T PLN02915         17 TCRVCGDEVGVKEDGQPFVACHVCGFPVCKPCYEYERSEGNQCCPQ---CNTRYKRHKGCPRVEGDDEEGNDMDDFEDE   92 (1044)
T ss_pred             hhhccccccCcCCCCCEEEEeccCCCccccchhhhhhhcCCccCCc---cCCchhhhcCCCCccCCccccccchhhhhh


No 493
>KOG1989 consensus ARK protein kinase family [Signal transduction mechanisms]
Probab=22.73  E-value=41  Score=36.16  Aligned_cols=26  Identities=0%  Similarity=0.055  Sum_probs=0.0

Q ss_pred             HHHHHHhhhhcccc--ccccCcchhhhH
Q 024658          227 TAIISSLRGLQNQT--MTDQGDAAAAIT  252 (264)
Q Consensus       227 t~i~~sl~~l~~~~--i~~~d~~~a~i~  252 (264)
                      .+|..++-+||...  |||||+|--|||
T Consensus       151 ~dv~~AVa~mH~~~pPiIHRDLKiENvL  178 (738)
T KOG1989|consen  151 YDVCEAVAAMHYLKPPIIHRDLKIENVL  178 (738)
T ss_pred             HHHHHHHHHHhcCCCccchhhhhhhheE


No 494
>KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms]
Probab=22.53  E-value=40  Score=34.95  Aligned_cols=24  Identities=8%  Similarity=0.178  Sum_probs=0.0

Q ss_pred             HHHHhhhhc---------cccccccCcchhhhH
Q 024658          229 IISSLRGLQ---------NQTMTDQGDAAAAIT  252 (264)
Q Consensus       229 i~~sl~~l~---------~~~i~~~d~~~a~i~  252 (264)
                      |..+|.+||         +..|.|||.|+.|||
T Consensus       316 marGLa~LHee~p~~d~~Kp~IaHRDlkSkNVL  348 (534)
T KOG3653|consen  316 MARGLAHLHEELPRGDHHKPPIAHRDLKSKNVL  348 (534)
T ss_pred             HHHHHHHhcccCCcCCCCCCccccccccccceE


No 495
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]
Probab=22.44  E-value=45  Score=36.08  Aligned_cols=20  Identities=55%  Similarity=0.976  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCCCCCCCC
Q 024658           98 SGHDETDDDDDYEDEDDDDD  117 (264)
Q Consensus        98 ~~~d~~~~dd~~~ded~~~d  117 (264)
                      |-+++.+++|++||||||+|
T Consensus       345 ~~~~~~~~eDdddDe~DDdD  364 (885)
T KOG2023|consen  345 GNGEDADDEDDDDDEDDDDD  364 (885)
T ss_pred             cCcccccccccccccccccc


No 496
>KOG0614 consensus cGMP-dependent protein kinase [Signal transduction mechanisms]
Probab=22.36  E-value=40  Score=35.70  Aligned_cols=24  Identities=4%  Similarity=0.131  Sum_probs=0.0

Q ss_pred             HHHHhhhhccccccccCcchhhhH
Q 024658          229 IISSLRGLQNQTMTDQGDAAAAIT  252 (264)
Q Consensus       229 i~~sl~~l~~~~i~~~d~~~a~i~  252 (264)
                      +++.+.|||.+.||-||.|+-|.+
T Consensus       529 v~EAfeYLH~k~iIYRDLKPENll  552 (732)
T KOG0614|consen  529 VLEAFEYLHRKGIIYRDLKPENLL  552 (732)
T ss_pred             HHHHHHHHHhcCceeccCChhhee


No 497
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=22.34  E-value=58  Score=23.20  Aligned_cols=24  Identities=29%  Similarity=0.726  Sum_probs=0.0

Q ss_pred             CCCCCCC-C---ceEEecCCCcc-ccccc
Q 024658            3 KCELCEC-P---ARMYCESDQAS-LCWDC   26 (264)
Q Consensus         3 ~Cd~C~~-p---A~vyC~aD~A~-LC~~C   26 (264)
                      .||.|+. |   .++.|....-+ ||..|
T Consensus         2 ~CDgCg~~PI~G~RykC~~C~dyDLC~~C   30 (43)
T cd02342           2 QCDGCGVLPITGPRYKSKVKEDYDLCTIC   30 (43)
T ss_pred             CCCCCCCCcccccceEeCCCCCCccHHHH


No 498
>PHA03346 US22 family homolog; Provisional
Probab=22.25  E-value=77  Score=32.76  Aligned_cols=49  Identities=37%  Similarity=0.490  Sum_probs=0.0

Q ss_pred             CCCCccccCCCCC------------------CCCCCCCCCCCCCCCCCCCCcchhhccccCCceecC
Q 024658           90 GGSQSERISGHDE------------------TDDDDDYEDEDDDDDDDEDPDEEEEEEDDENQVVPW  138 (264)
Q Consensus        90 ~g~p~~~~~~~d~------------------~~~dd~~~ded~~~dd~e~e~~~~~ee~~enqvVp~  138 (264)
                      .+.|...+++.++                  .+|++++++|+||+-++..-+.|++.=.+=-+|-+|
T Consensus       395 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~  461 (520)
T PHA03346        395 PRGPPENEDEADGGGGLAPPPEPPRPPPPPFPDDDDEGDDEDDDDWEDLGFDLDEDDVYDLKDVDEW  461 (520)
T ss_pred             CCCCCCcccccccccCcCCCCCCCCCCCCCCCCcccccccccccccccCCccccccccccchhhhhh


No 499
>PF01056 Myc_N:  Myc amino-terminal region;  InterPro: IPR012682 The class III basic helix-turn-helix (bHLH) transcription factors have proliferative and apoptotic roles and are characterised by the presence of a leucine zipper adjacent to the bHLH domain. The myc oncogene gene was first discovered in small-cell lung cancer cell lines where it is found to be deregulated []. Although the biochemical function of the gene product is unknown, as a nuclear protein with a short half-life it may play a direct or indirect role in controlling gene expression []. Myc forms a heterodimer with Max, and this complex regulates cell growth through direct activation of genes involved in cell replication []. This entry represents the N-terminal domain found adjacent to the basic helix-loop-helix (bHLH) region (IPR001092 from INTERPRO).; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 1EE4_C.
Probab=22.11  E-value=30  Score=33.70  Aligned_cols=27  Identities=41%  Similarity=0.705  Sum_probs=0.0

Q ss_pred             CCCCCCCCCCCCCcchhhccccCCcee
Q 024658          110 EDEDDDDDDDEDPDEEEEEEDDENQVV  136 (264)
Q Consensus       110 ~ded~~~dd~e~e~~~~~ee~~enqvV  136 (264)
                      ....+...++++++++++||++|.-||
T Consensus       221 ssgsd~~s~~~~~~~eeeeeeEEIDVV  247 (329)
T PF01056_consen  221 SSGSDSESDSDEEEEEEEEEEEEIDVV  247 (329)
T ss_dssp             ---------------------------
T ss_pred             ccccccccccccccccccCCCcceEEE


No 500
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=22.03  E-value=79  Score=32.44  Aligned_cols=33  Identities=27%  Similarity=0.447  Sum_probs=0.0

Q ss_pred             ecCCCCCCCCCCCCCCCCCC-------CCCCccccchhhh
Q 024658          136 VPWSGDDSQSPPQPPPPPVS-------SSCSSISEEDFSL  168 (264)
Q Consensus       136 Vp~s~~~~~~~~~~~pp~~s-------sss~~~~~~~~~~  168 (264)
                      .+.++++..+||+||||++.       ++++....+-.+|
T Consensus       228 ~~~s~~g~PPPPPP~PPp~~~~~~~~~~~~~~~k~~~~Al  267 (480)
T KOG2675|consen  228 KAASAPGAPPPPPPAPPPAPFFADSNPPSSDANKGGRGAL  267 (480)
T ss_pred             CcccCCCCCCCCCCCCCCcccccccCCCCcccccccHHHH


Done!