Citrus Sinensis ID: 024675


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MKRFSSSDSFDALITVYKSADKTSTKRKQIYGREFQAMMDCLEEEDCREEASQATEKKRRLTVDQVKALEKNFEVDNKLEPDRKVKLAEELGLQPRQIAVWFQNRRARLKSKELERDYGLLKANYDALRLDYNNLQQENEALTAELRELKAKLCQENEETSHAVEAEAPVSEQSKNHVSSENANAQLLTSPPSFSPLFTGSSSSSHPSMNWVQFSDSRTILSNVYQQPQLVKVEEQSLLFNPEDPCNIFSVDQAPTLQWYFTGH
cccccccccccccccccccccccccccccccccccHHHHcccccccHHHHHcccccccccccHHHHHHHHHHcHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***************************************************************DQVKALEKNFEVDNKLEPDRKVKLAEELGLQPRQIAVWFQNRRARLKSKELERDYGLLKANYDALRLDYNNLQ*******************************************************************************D***ILSNVYQQPQLVKVEEQSLLFNPEDPCNIFSVDQAPTLQWYF***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKRFSSSDSFDALITVYKSADKTSTKRKQIYGREFQAMMDCLEEEDCREEASQATEKKRRLTVDQVKALEKNFEVDNKLEPDRKVKLAEELGLQPRQIAVWFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSHAVEAEAPVSEQSKNHVSSENANAQLLTSPPSFSPLFTGSSSSSHPSMNWVQFSDSRTILSNVYQQPQLVKVEEQSLLFNPEDPCNIFSVDQAPTLQWYFTGH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox-leucine zipper protein ATHB-6 Transcription activator that may act as growth regulators in response to water deficit. Interacts with the core sequence 5'-CAATTATTA-3' of promoters in response to ABA and in an ABI1-dependent manner. Involved in the negative regulation of the ABA signaling pathway.probableP46668

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1B72, chain A
Confidence level:very confident
Coverage over the Query: 57-113
View the alignment between query and template
View the model in PyMOL
Template: 1I84, chain S
Confidence level:probable
Coverage over the Query: 92-153
View the alignment between query and template
View the model in PyMOL