Citrus Sinensis ID: 024679

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MSSVGISSIYSGCSVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSPGIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSNGRRLFVGYLSVASLISMFASPLFIIVSSSGTQAFRLLRLHISLHSYGCMYIFMQKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGMFKDDPFIYVPNGIGTLLGIAQVMLYSYYSTKSGEVSRQPLIDSFA
cccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccEEEEEEEcHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHEEEECccccEEEEHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHHHHHHHHEEEEEcccccccccccccccc
*****ISSIYSGCSVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSPGIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSNGRRLFVGYLSVASLISMFASPLFIIVSSSGTQAFRLLRLHISLHSYGCMYIFMQKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGMFKDDPFIYVPNGIGTLLGIAQVMLYSYYST***************
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSVGISSIYSGCSVAAGVTGNIFAFVLFVSPIPTFRRILRNKSTEQFSGLPYICSLLNCLITLWYGMPLVSPGIILVATVNSVGAVFQLIYVSIFISYAEKAIKLKISGLLIAVFLVFLAIVFTSMEVFDSNGRRLFVGYLSVASLISMFASPLFIIVSSSGTQAFRLLRLHISLHSYGCMYIFMQKLVIKTRSVEFMPFYLSLSNFLMSLSFLAYGMFKDDPFIYVPNGIGTLLGIAQVMLYSYYSTKSGEVSRQPLIDSFA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bidirectional sugar transporter SWEET2 Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.probableQ9LH79
Bidirectional sugar transporter SWEET2a Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.probableQ5JJY5
Bidirectional sugar transporter SWEET2a Mediates both low-affinity uptake and efflux of sugar across the plasma membrane.probableA2WR31

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted