BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 024686
(264 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1G1A|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb)from Salmonella Enterica Serovar Typhimurium
pdb|1G1A|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb)from Salmonella Enterica Serovar Typhimurium
pdb|1G1A|C Chain C, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb)from Salmonella Enterica Serovar Typhimurium
pdb|1G1A|D Chain D, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb)from Salmonella Enterica Serovar Typhimurium
pdb|1KEU|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb) From Salmonella Enterica Serovar Typhimurium With
Dtdp-D-Glucose Bound
pdb|1KEU|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb) From Salmonella Enterica Serovar Typhimurium With
Dtdp-D-Glucose Bound
pdb|1KEW|A Chain A, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb) From Salmonella Enterica Serovar Typhimurium With
Thymidine Diphosphate Bound
pdb|1KEW|B Chain B, The Crystal Structure Of Dtdp-D-Glucose 4,6-Dehydratase
(Rmlb) From Salmonella Enterica Serovar Typhimurium With
Thymidine Diphosphate Bound
Length = 361
Score = 28.1 bits (61), Expect = 5.7, Method: Compositional matrix adjust.
Identities = 16/40 (40%), Positives = 22/40 (55%), Gaps = 1/40 (2%)
Query: 218 FEDMSCEMVYGQVPPSFEDDPVSTQPCFTDICSNANPSSP 257
F +S + VYG +P E + T P FT+ + A PSSP
Sbjct: 128 FHHISTDEVYGDLPHPDEVENSVTLPLFTETTAYA-PSSP 166
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.321 0.136 0.433
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,796,719
Number of Sequences: 62578
Number of extensions: 303013
Number of successful extensions: 648
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 648
Number of HSP's gapped (non-prelim): 1
length of query: 264
length of database: 14,973,337
effective HSP length: 97
effective length of query: 167
effective length of database: 8,903,271
effective search space: 1486846257
effective search space used: 1486846257
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)