BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024692
         (264 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Agrobacterium Tumefaciens
 pdb|3R31|B Chain B, Crystal Structure Of Betaine Aldehyde Dehydrogenase From
           Agrobacterium Tumefaciens
          Length = 517

 Score = 30.0 bits (66), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 21/45 (46%)

Query: 142 AMVLGAPLDDARHLAQRYDRMRQEAEAQAIEVSKRQAKVRETPGN 186
           AM+LG PLD A HL     + +QE     IE  K +     T G 
Sbjct: 318 AMILGDPLDYATHLGPLVSKAQQEKVLSYIEKGKAEGATLITGGG 362


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.129    0.342 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,041,933
Number of Sequences: 62578
Number of extensions: 208161
Number of successful extensions: 607
Number of sequences better than 100.0: 8
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 601
Number of HSP's gapped (non-prelim): 8
length of query: 264
length of database: 14,973,337
effective HSP length: 97
effective length of query: 167
effective length of database: 8,903,271
effective search space: 1486846257
effective search space used: 1486846257
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)