BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024720
         (263 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1W5D|A Chain A, Crystal Structure Of Pbp4a From Bacillus Subtilis
 pdb|2J9P|A Chain A, Crystal Structure Of The Bacillus Subtilis Pbp4a, And Its
           Complex With A Peptidoglycan Mimetic Peptide.
 pdb|2J9P|B Chain B, Crystal Structure Of The Bacillus Subtilis Pbp4a, And Its
           Complex With A Peptidoglycan Mimetic Peptide
          Length = 462

 Score = 31.2 bits (69), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 19/45 (42%), Gaps = 2/45 (4%)

Query: 148 VPFKKMSENVHHHQLTAEFVARTVNRGSYFWSLGLRAFYFSFPLF 192
           VPF K+S N H   L  E     V +G   W  GL     + P F
Sbjct: 293 VPFMKLSNNGHAEVLVKEM--GKVKKGEGSWEKGLEVLNSTLPEF 335


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.328    0.140    0.435 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,776,762
Number of Sequences: 62578
Number of extensions: 223220
Number of successful extensions: 544
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 543
Number of HSP's gapped (non-prelim): 2
length of query: 263
length of database: 14,973,337
effective HSP length: 97
effective length of query: 166
effective length of database: 8,903,271
effective search space: 1477942986
effective search space used: 1477942986
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 50 (23.9 bits)