Citrus Sinensis ID: 024748


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260---
MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIEPNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFEDPDIIHVDDSVDPVRDLEVISAELRLKDIEFMERRIEDVEKSMKRSNDKQLKIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWCVLIFKLNNDLSP
ccccccccccccccccccccccccccEEEEccccccHHHHHHHHHccccccccccccccccccCEEccccHHHHHHHHHcccccccccEEEEEEcccccccccccccccHHHHHHHHHHccEEEEEEEcccccEEEEccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccHHcHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHHHHHHHHccccccccc
****************ILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIEPNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFEDPDIIHVDDSVDPVRDLEVISAELRLKDIEFMERRIE**************KIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWCVLIFKLNNDL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPPKASKSKEAPAERPILGRFSSHLKIGIVGLPNVGKSTLFNTLTKLAIPAENFPFCTIEPNEARVNIPDERFEWLCQLFKPKSAVPAFLEIHDIAGLVRGAHEGQGLGNSFLSHIRAVDGIFHVLRAFEDPDIIHVDDSVDPVRDLEVISAELRLKDxxxxxxxxxxxxxxxxxxxxxQLKIEHELCQRVKAWLQDGKDVRLGDWKAADIEILNTFQLLTAKPVVYLVNMNEKDYQRKKNKFLPKIHAWCVLIFKLNNDLSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Obg-like ATPase 1 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.probableA0JPJ7
Obg-like ATPase 1 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.probableQ2HJ33
Obg-like ATPase 1 Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP.probableQ9NTK5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OHF, chain A
Confidence level:very confident
Coverage over the Query: 20-46,60-97,109-128,141-253
View the alignment between query and template
View the model in PyMOL