Citrus Sinensis ID: 024790


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
MLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE
ccEEEEEEccHHHHHHHHHHccccEEEEEECcccccCEEEEEEccccccccEEEEEEccccccccccccCEEEEEECccHHHHHHHHHHcccEEEEccccccccccEEEEEEcccccEEEEEEccccccccccEEEEcccHHHHHHHHHHccccEEEEECccccccEEEEEEEccccccccEEEEEEcccccccccccccEEEEEEcccHHHHHHHHHHcccCEEccccccccccCEEEEEEcccccEEEEEEccccccccc
MLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFL****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLHVVYRVGDLDRTIKFYTECLGMKLLRKRDIPEEKYTNAFLGYGPEDSHFVIELTYNYGVDKYDIGTGFGHFGIAVDDVAKTVELIKAKGGKVTREPGPVKGGNTVIAFIEDPDGYKFELLERGPTPEPLCQVMLRVGDLDRSINFYEQAFGMELLRKRDNPEYKYTIAMMGYGPEDKNVVLELTYNYGVTDYDKGNAYAQIAIGTDDVYKTAEAIKLFGGKVTREPGPLPGINTKITACLDPDGWKTVFVDNVDFLKELE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable lactoylglutathione lyase, chloroplast Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.confidentQ8W593
Putative lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.probableQ39366
Lactoylglutathione lyase Catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione, to S-lactoylglutathione.probableQ948T6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
4.-.-.-Lyases.probable
4.4.-.-Carbon-sulfur lyases.probable
4.4.1.-Carbon-sulfur lyases.probable
4.4.1.5Lactoylglutathione lyase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F9Z, chain A
Confidence level:very confident
Coverage over the Query: 1-124
View the alignment between query and template
View the model in PyMOL
Template: 1F9Z, chain A
Confidence level:very confident
Coverage over the Query: 130-254
View the alignment between query and template
View the model in PyMOL