Citrus Sinensis ID: 024829

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--

MEVAAAYPSFSLLHLRSRKSSTHSCLSRLCPYKGLGCSAYNQAVLRNPYSSAQNGFQCITRKRVGFSWPNFDLKLNRRCYDIKFSRNVVVRSQLAGTGTPDAAYPLSELKLGSKVRGICFYAVTAVVAIFLIVLMLVGHPFVLLLDRYRRKFHHFIAKLWATLTVSPFLKLEIEGLENLPSSDTPAVYVSNHQSFLDIYTLLTLGKSFKFISKTGIFLFPVIGWAMSMMGVIPLKRMDSRSQLAQVSALHPLGFEIFIGFLV

cccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccEEECccccCCcccccccccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEECccccccccEEEEEccccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHcccCEECcccHHHHHHHHHHHHHccccEEEEEcc

*****AYPSFSLLH**********CLSRLCPYKGLGCSAYNQAVLRNPYSSAQNGFQCITRKRVGFSWPNFDLKLNRRCYDIKFSRNVVVRSQLAGTGTPDAAYPLSELKLGSKVRGICFYAVTAVVAIFLIVLMLVGHPFVLLLDRYRRKFHHFIAKLWATLTVSPFLKLEIEGLENLPSSDTPAVYVSNHQSFLDIYTLLTLGKSFKFISKTGIFLFPVIGWAMSMMGVIPLKRMDSRSQLAQVSALHPLGFEIFIGFLV

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
2.-.-.-	Transferases.	probable
2.3.-.-	Acyltransferases.	probable
2.3.1.-	Transferring groups other than amino-acyl groups.	probable
2.3.1.51	1-acylglycerol-3-phosphate O-acyltransferase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IUQ, chain A
Confidence level:probable
Coverage over the Query: 155-259
View the alignment between query and template
View the model in PyMOL