Citrus Sinensis ID: 024851


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MHQDAHEFLNFLLNELVDILEKEEAAKSDPESSSPSEKTANGPTNGLANGVRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLGAGSNKS
ccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEcccccccccccccEEEEECccccccHHHHHHHcccccccccccccccccccccEEEEEEEEEcccccEEEEEEcccccccccccccccccEEEcccccccccccccccccEEEEEEEEECccccccccEEEEEEEcccEEEECcccCEECcHHHHHHHHccccccccccccEEEEEEEECccccccc
MHQDAHEFLNFLLNELVDILE*****************************VRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLG******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHQDAHEFLNFLLNELVDILEKEEAAKSDPESSSPSEKTANGPTNGLANGVRKEPLVTWVHKNFQGILTNETRCLRCETVTARDETFFDLSLDIEQNSSITSCLKNFSSTETLNAEDKFFCDKCCSLQEAQKRMKIKKSPHTLVIHLKRFKYIEQLGRYKKLSYRVVFPLELKLSNTAEDADIEYSLFAVVVHVGSGPNHGHYVSLVKSHNHWLFFDDENVEMIDESAVQTFFGSAQEYSSNTDHGYILFYESLGAGSNKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 4 Recognizes and hydrolyzes the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. Required for the correct development of pollen.probableQ8LAM0
Ubiquitin carboxyl-terminal hydrolase 46 Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. Has almost no deubiquitinating activity by itself and requires the interaction with wdr48 to have a high activity.probableA5WWB0
Ubiquitin carboxyl-terminal hydrolase 46 Deubiquitinating enzyme that plays a role in behavior, possibly by regulating GABA action. May act by mediating the deubiquitination of GAD1/GAD67. Has almost no deubiquitinating activity by itself and requires the interaction with WDR48 to have a high activity. Not involved in deubiquitination of monoubiquitinated FANCD2.probableP62068

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.4.-.-Acting on peptide bonds (peptide hydrolases).probable
3.4.19.-Omega peptidases.probable
3.4.19.12Ubiquitinyl hydrolase 1.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IHP, chain A
Confidence level:very confident
Coverage over the Query: 1-22,57-178
View the alignment between query and template
View the model in PyMOL
Template: 3NHE, chain A
Confidence level:very confident
Coverage over the Query: 1-230,243-255
View the alignment between query and template
View the model in PyMOL