BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 024855
         (261 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
           Pyrophosphate Synthase
 pdb|3APZ|B Chain B, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
           Pyrophosphate Synthase
          Length = 348

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 131 LRHAVNPSTLIFLIHVFPQVKFVPSPLGKLPRN 163
           +RH V  + ++F +  FPQ++ V   + K PRN
Sbjct: 254 IRHGVITAPILFAMEEFPQLREVVDQVEKDPRN 286


>pdb|3HK0|A Chain A, Crystal Structure Of The Ra And Ph Domains Of Grb10
 pdb|3HK0|B Chain B, Crystal Structure Of The Ra And Ph Domains Of Grb10
          Length = 256

 Score = 28.9 bits (63), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 13/31 (41%), Positives = 20/31 (64%)

Query: 167 PEQLETFMAQETGKRRQLLQKFLDTCSQSKV 197
           PEQ+ T+  Q  G + QLLQ FL++ S  ++
Sbjct: 104 PEQMVTWSQQSNGSQTQLLQNFLNSSSSPEI 134


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.389 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,923,907
Number of Sequences: 62578
Number of extensions: 207125
Number of successful extensions: 453
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 449
Number of HSP's gapped (non-prelim): 5
length of query: 261
length of database: 14,973,337
effective HSP length: 97
effective length of query: 164
effective length of database: 8,903,271
effective search space: 1460136444
effective search space used: 1460136444
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)