Citrus Sinensis ID: 024891


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MGCCGEQNDAEEELQNHLLSSSSSSASSFTDPSTVISPMNSHFSALACPDTLRLILSNLSVTDLARASCVCRAWSSVASDNNMIVLAFMAPWKLKEVVGMPLNGSFWRDNGIGKFAISHRLARGDTVASLAVKYSVQVMDIKRLNNMMSDHGIYSRERLLIPISSPELLIDGICYIEFDTYAKREVAVLYLEGAPEKKPSCLLNRVTSVHGRRRIINSLRRSMQVDDETAQYYLSISNGNLRAALSEFSADLEWERQGALA
ccccccccccHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccccccccccccccccccccccccEEEEEEcccccHHHHHHHHHcccHHHHHHHHccccccccccccEEEEccccccccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccc
*****************************************HFSALACPDTLRLILSNLSVTDLARASCVCRAWSSVASDNNMIVLAFMAPWKLKEVVGMPLNGSFWRDNGIGKFAISHRLARGDTVASLAVKYSVQVMDIKRLNNMMSDHGIYSRERLLIPISSPELLIDGICYIEFDTYAKREVAVLYLEG****************************SMQVDDETAQYYLSISNGNLRAALSEFSADLEWERQ****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCCGEQNDAEEELQNHLLSSSSSSASSFTDPSTVISPMNSHFSALACPDTLRLILSNLSVTDLARASCVCRAWSSVASDNNMIVLAFMAPWKLKEVVGMPLNGSFWRDNGIGKFAISHRLARGDTVASLAVKYSVQVMDIKRLNNMMSDHGIYSRERLLIPISSPELLIDGICYIEFDTYAKREVAVLYLEGAPEKKPSCLLNRVTSVHGRRRIINSLRRSMQVDDETAQYYLSISNGNLRAALSEFSADLEWERQGALA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
F-box protein At1g55000 Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.probableQ9FZ32

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EBY, chain A
Confidence level:confident
Coverage over the Query: 45-166
View the alignment between query and template
View the model in PyMOL
Template: 1OAI, chain A
Confidence level:probable
Coverage over the Query: 212-253
View the alignment between query and template
View the model in PyMOL