Citrus Sinensis ID: 024924

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260

MPELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKAILSAHRKGKNLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSYISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVIQSAVEVDADCSRFPLEWLFHFRWGKKPGKVNGKIFMT

ccccHHHHHHHHHHHHHHcccEEEEEEEEccccccccccHHHHHHHccccEEEEEcccccEEEEEccccccEEEEcccccEEEEEEccccccccccccccccccccEEEEEEEEccccEEEEcccccccEEEECccccccccccccccccccccccHHHHHHHHccccccHHHHHHccccEEccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccccccccccccEEc

**ELPEVEAARRAIEEHCIGKKIVKSIIADDNKVIDGVSASDFEASVLGKAILSAHRKGKNLWLRLDSPPFPSFQFGMTGAIYIKGVAVTQYKRSAVKDTDEWPSKYSKFFVELDDGLELSFTDKRRFAKVRLLNDPTSVPPISELGPDALLEPMTVDEFTDSLSKKKITIKALLLDQSYISGIGNWVADEVLYQAKIHPLQTAVSLSKESCATLLKCIKEVIQSAVEVDADCSRFPLEWLFHFRWGKKPGKVNGKI***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Formamidopyrimidine-DNA glycosylase	Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.	probable	A4QFD9
Formamidopyrimidine-DNA glycosylase	Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.	probable	B0TER7
Formamidopyrimidine-DNA glycosylase	Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized purines, such as 7,8-dihydro-8-oxoguanine (8-oxoG). Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'-phosphates.	probable	Q24XW2

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
4.-.-.-	Lyases.	probable
3.-.-.-	Hydrolases.	probable
3.2.-.-	Glycosylases.	probable
4.2.-.-	Carbon-oxygen lyases.	probable
4.2.99.-	Other carbon-oxygen lyases.	probable
3.2.2.-	Hydrolyzing N-glycosyl compounds.	probable
4.2.99.18	Transferred entry: 4.2.99.18.	probable
3.2.2.23	DNA-formamidopyrimidine glycosylase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TWL, chain A
Confidence level:very confident
Coverage over the Query: 2-85,103-259
View the alignment between query and template
View the model in PyMOL